KEGG   Anaerolinea thermophila: ANT_13970Help
Entry
ANT_13970         CDS       T01410                                 

Gene name
parB
Definition
(GenBank) chromosome partitioning protein ParB
  KO
K03497  
chromosome partitioning protein, ParB family
Organism
atm  Anaerolinea thermophila
Brite
Transcription factors [BR:atm03000]
 Prokaryotic Type
  Other transcription factors
   Others
    ANT_13970 (parB)
Chromosome [BR:atm03036]
 Prokaryotic Type
  Chromosome partitioning proteins
   Other chromosome partitioning proteins
    ANT_13970 (parB)
Cytoskeleton proteins [BR:atm04812]
 Prokaryotic cytoskeleton proteins
  MinD / ParA class of bacterial cytoskeletal proteins
   ANT_13970 (parB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NITE: 
UniProt: 
Position
complement(1559709..1560563)
Genome map
AA seq 284 aa AA seqDB search
MARKGGLGKGLGALIPGESPQSEGGVISLPIHQIKPNPRQPRTEINEAHLQELAESIREH
GVLQPVLVTTEPGKDGYYLVAGERRLRAAQMAGLELIPAIIRSVSEQERLELALIENLQR
EDLSPLETAEAYQKLVEEFGLRHEDIAIRVGKSREAVSNTLRLLNLSAEVKKALQSGQIS
EGHARALLGLPHEAAQNALLKVILEQGLTVRQTEELVRKMSGERPQKRRKRGLSPELQEY
EEQLRSRFGTKVSIRHGQKGGAIVIYYFSEEEFDHLLHQFLGNS
NT seq 855 nt NT seq  +upstreamnt  +downstreamnt
atggcacgcaaaggtggattgggaaaaggtttaggcgcactgattcccggggaatccccc
caaagtgaaggtggtgtgatctccctgcccattcatcaaatcaaacccaatcctcgccaa
ccccgtacagaaataaacgaagcccatttacaggaattagccgaatcgattcgcgaacac
ggagtgttacaacctgtactggtcaccacagaacctgggaaagatgggtattaccttgtt
gcgggagagagacgtctgcgggcggctcaaatggctggactggagttgattcccgcgatc
atccgttcagtaagcgaacaggaacgccttgaactggcactgattgaaaatctacaacgg
gaagacctctctccccttgagacggcagaggcgtaccagaaactggtagaagaatttggt
ttacggcatgaagacattgccatccgggtaggaaaaagccgcgaagccgtgagcaatact
ctgcgacttctcaacctctctgcagaagtcaagaaagccctgcaaagcggacaaatcagc
gaaggacatgcccgtgcattactggggttaccccacgaagccgcccagaatgccctgttg
aaagtcattctggaacagggtttgaccgtacgacagacagaagaactggtgcgaaagatg
tcgggggaacgtccgcagaaacggcgtaagcggggactttccccggaacttcaggaatat
gaagagcaattgcgttctcgctttggcaccaaagtctccattcgccatggacaaaagggt
ggagccattgtcatttactatttctccgaagaagagtttgatcatttactccatcaattt
ttggggaattcatga

DBGET integrated database retrieval system