KEGG   Anaerolinea thermophila: ANT_14000Help
Entry
ANT_14000         CDS       T01410                                 

Definition
(GenBank) hypothetical protein
Organism
atm  Anaerolinea thermophila
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DZR zf-ribbon_3 zinc_ribbon_2 UPF0547 zinc_ribbon_15 Prok-RING_1 PolC_DP2 HypA NMD3 DUF4131 DuoxA Voltage_CLC FtsK_4TM CCSMST1 Prok-RING_4 zf-C2HC_2
Motif
Other DBs
NCBI-ProteinID: BAJ63428
NITE: ANT_14000
UniProt: E8N4R4
Position
complement(1562231..1562782)
Genome map
AA seq 183 aa AA seqDB search
MTVDPVFLSNFLLISVGFTAAFLAALWLSLIFWVFRDIRRRTRDTLVHILAVLVVAILFL
PGMLIYFILRPPKTLEEEFQQSLEEEALLQTIEESLLCPGCGRKVKEDWVACPACYTRLK
KTCHQCGKPIELSWNLCPYCGTPAPGMRRETLSIDDAMRNLVMESELKSSTEPVSSSEDP
DQV
NT seq 552 nt NT seq  +upstreamnt  +downstreamnt
atgactgttgaccctgtttttctatcgaattttctcttaatctcagtgggattcacggct
gcgtttctggcagcgctctggttgagtctgatcttttgggttttcagggatatccgccgc
cgcacccgcgacacactggtgcacattcttgccgtgctggtggttgccattctcttcctg
ccaggaatgctcatttactttatcctgcgccccccaaaaacactggaagaggaatttcaa
cagtctctcgaggaagaagcccttttgcaaaccattgaggaaagtctgttatgcccggga
tgtggtagaaaggtcaaggaagactgggtggcttgtcctgcatgttatacccgtctgaag
aagacctgtcaccaatgcggaaagcctattgaactttcctggaatttgtgtccatattgt
ggcacccccgctccgggaatgcgccgagaaaccctgtccatcgacgatgcaatgagaaat
ctggtcatggaaagcgaattaaaatcttcaacagagcctgtttcctcttccgaagatcca
gatcaagtataa

DBGET integrated database retrieval system