KEGG   Anaerolinea thermophila: ANT_14070Help
Entry
ANT_14070         CDS       T01410                                 

Definition
(GenBank) putative deacetylase
Organism
atm  Anaerolinea thermophila
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PIG-L
Motif
Other DBs
NCBI-ProteinID: BAJ63435
NITE: ANT_14070
UniProt: E8N4S1
Position
1569806..1570675
Genome map
AA seq 289 aa AA seqDB search
MKIMDMETKRALLAVLAHPDDETFGMGGTLALYARQGVDVYLICATRGEAGEVEKEHLQG
FSTVAERRESELRCAANILGLKGVFFLGYRDSGMPGSVDNFHPQALCVQPVEEVAERIAS
LILEIKPQVVITFDPIGGYRHPDHVAIHQATVRAFERLAMLQQEGKAVNPVKKLYFHTIP
RTLLRLIVLAMKLRGKDPRRFGKNGDIDLASIAAEQFPIHAVVDYRQVARVRERAVACHV
SQGGASLTGVGIFAQIRRWFFSRDVFMRAYPPAGKGSPKENDLFEGIYE
NT seq 870 nt NT seq  +upstreamnt  +downstreamnt
ttgaagataatggacatggaaacaaaacgcgctttactggctgtgctggctcatccagat
gacgaaacgtttggtatggggggaacattagcattatatgctcgtcagggggttgatgtt
tatttgatctgtgccacccgcggagaggctggagaggttgaaaaggagcatcttcagggt
ttttccaccgttgctgagcgcagggagtcggaactgcgctgtgcggcaaatattcttggg
ctgaaaggcgtattttttctggggtatcgtgattcgggtatgccaggctcggtagacaat
tttcacccccaagccttatgtgtgcaaccagttgaagaagtagccgaacggattgcgtct
ctcattctggaaattaagccacaggtagtcattactttcgatcccattggcggttaccgt
cacccagatcatgtggcaattcatcaggctactgtgagagcctttgaacggcttgccatg
cttcagcaggaaggtaaagcagttaatccggttaaaaaattgtactttcacaccattccc
cgcacattgcttcgcctaatagtgcttgccatgaaacttcgcgggaaagatccacgtcgt
tttggaaaaaatggcgatatcgatctggcttctatcgcagccgagcagttccctattcac
gccgtagtggattatcggcaggtggctcgggttcgggaacgcgcagtggcttgtcatgtc
agtcaggggggtgcttccttaactggtgtgggaatttttgcacaaattcgtcgctggttc
ttttcccgggatgtattcatgcgggcttatccgcctgcaggaaaaggttctccaaaagaa
aacgatctctttgaaggaatctatgaataa

DBGET integrated database retrieval system