KEGG   Anaerolinea thermophila: ANT_14080Help
Entry
ANT_14080         CDS       T01410                                 

Gene name
clpB
Definition
(GenBank) chaperone ClpB
  KO
K03695  
ATP-dependent Clp protease ATP-binding subunit ClpB
Organism
atm  Anaerolinea thermophila
Brite
Chaperones and folding catalysts [BR:atm03110]
 Heat shock proteins
  HSP100
   ANT_14080 (clpB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NITE: 
UniProt: 
Position
complement(1570725..1573310)
Genome map
AA seq 861 aa AA seqDB search
MNLDKFTQKAQEAILKSQQLAQDYNHQAIEPAHLLLALIQQSEGVVPAIITRVAGSTLAL
REELVQELARRPKVYGSNASIGLAQPTVEVLNRSEQYAKGMQDEYISTEHILLALTDSPE
NKRLSQYGLTKDAILKALASIRGSQRVTSPTPEDTYQALEKYGRDLTAMARQGKLDPVIG
RDEEIRRTIQILSRRTKNNPALIGEPGVGKTAIVEGLAQRIVNGDVPEGLKRKRIIQLDM
GALVAGAKYRGEFEERLKAVLKEVTDAAGEVILFIDEMHTVVGAGAAEGAMDAGNMLKPM
LARGELHMIGATTLDEYRKHIEKDPALERRFQPILVEEPSVEDTISILRGLKSRYEVHHG
VRITDAAVITAATLSHRYIPDRHLPDKAIDLIDEAAARLRTEIDSKPQAIDEVDRQILQL
EIERQALQKERDKASQERLSKLEQELANLKEKSASLHARWKLEKEAIANLRQVKEQIDQT
YRDIERAERENNLEEAARLRYGVLHELQNKVKEAEKRLAEIQQEGALLKEEVDAEEIAEI
VSRWTGIPVSRLLEGEMKKLLEMEERLHQRVVGQDEAVRAVSNAIRRARAGLQDPNRPIG
SFIFLGPTGVGKTELARALAEFMFDDEHAMIRIDMSEYQEKHTVSRLIGAPPGYVGYEEG
GQLTEAVRRRPYSVVLFDEIEKAHPEVFNVLLQLLDDGRLTDGQGRTVDFRNVVVIMTSN
LGSELWLSNVGQVSREQITRVLQAHFRPEFLNRIDEVVVFHPLGQEHLQKIVEIQLRRMQ
NLLEERGYHLEVTKEAKAYLAEVGYDPDFGARPLKRAIQRELQDPLALHLLNGEFKPGDT
IRVERVPDGLAFVPVVSAEVA
NT seq 2586 nt NT seq  +upstreamnt  +downstreamnt
atgaacctcgataaatttacacaaaaagcacaagaagccatcctgaagagtcagcaactg
gcacaggattacaaccatcaggcaatcgagccagcacatttgttgctggctttaatccag
caaagcgaaggtgttgtaccggccatcattacccgggttgccgggtcaacactggcactt
agagaggaactcgttcaagagttagccagacgccccaaggtatacggctctaatgcatca
ataggccttgcccagcccacagttgaggtgctcaatcgctctgagcaatatgcaaaagga
atgcaggatgagtacatctccacagagcacatcttactggctttaaccgactctcctgag
aacaaacgtttatcgcaatatggcttgaccaaggatgctattctaaaagctctggcttca
attcgcggaagtcaacgcgtaacctcacctacaccggaagatacctatcaggcactggaa
aaatatggcagagacctaactgccatggcacggcagggaaaacttgatccggtgattgga
cgggatgaggaaattcgcagaaccattcaaatcctttcgcgcaggacaaaaaacaacccc
gcattgatcggtgagcctggtgtaggaaaaaccgccattgtggaaggactggcacaacgt
attgtcaacggggatgtgcccgaaggcttaaagcgaaaacgcatcatccagttggatatg
ggtgccttggttgccggtgcaaaataccgtggggaatttgaagaacgcctgaaggcagtt
ttgaaagaagtgactgacgccgctggggaggtcatcctctttattgacgaaatgcacact
gtggtaggagcaggtgctgcagagggcgccatggatgccggcaatatgctcaaaccgatg
ctggcgcgcggggaacttcacatgattggcgcaaccacgctggacgagtaccgcaaacac
atcgaaaaagacccggcgctggaacgtcgtttccaacccatcctggtagaagaaccctcg
gtagaagataccatcagcatcctgcgaggattgaaatctcgctacgaggttcaccatggt
gtacggattaccgatgccgctgtcatcactgcagcaacgctttcacatcgctatatcccg
gatcggcacctgcctgataaagccattgacctgattgacgaagcggcagcacgattacga
actgagatcgactctaaacctcaagcgattgacgaggttgatcgccagattcttcaactt
gaaattgagcggcaagccctgcaaaaagaacgagacaaggcttcgcaggagcgcttgagt
aaactggagcaagaacttgccaaccttaaggaaaaatctgccagtttacacgcacggtgg
aaactggaaaaagaagccattgccaacttgagacaggtgaaggaacaaattgaccagact
tatcgggatatcgagcgggcagagcgagaaaacaacctcgaagaagccgcgcgcctgcgc
tatggcgtcttgcatgaacttcaaaacaaagtgaaagaagccgaaaaacggctggctgaa
attcaacaggaaggcgcgctgttgaaagaggaagtggatgccgaagaaattgcggagatt
gtttcgcgctggacaggcatcccggtctcgcggttgctggagggcgagatgaaaaaattg
ctcgaaatggaagagcgtctgcatcaacgcgtagtaggacaggatgaggcggtacgcgca
gtatcgaatgccattcgtcgagcgcgtgccggcttacaggaccccaaccgtcctatcgga
tcattcatcttcctgggaccgacaggggttggcaaaaccgaacttgctcgtgcactggct
gagtttatgtttgatgacgaacacgccatgattcgcatcgacatgagcgaatatcaggaa
aagcataccgtttcacgcctcatcggtgcgcccccgggttatgtgggctatgaagaaggt
ggtcaactcaccgaagccgttcgtcgtcgtccgtacagcgtggtgctgtttgatgaaatc
gagaaagctcatccagaagtgttcaacgtcttgctccaattactcgatgatggacgattg
accgatgggcagggaaggacagtagattttcgcaacgtggttgtcatcatgaccagtaac
ctgggctcagaactgtggttgagcaacgttggacaggtaagccgcgaacaaatcacccgg
gtcttgcaagcccacttccgccctgagttccttaaccgcattgacgaggtggttgttttc
cacccgttgggacaggaacacctgcaaaaaattgtcgaaattcaactgcggcgcatgcaa
aacctgttggaagaacgtggttatcatctcgaagttaccaaggaagccaaagcctatctg
gcagaagtgggatacgatccggacttcggggcgcgtccactcaaacgtgccatccagcga
gaacttcaggacccgctggctcttcacttgctgaatggcgaattcaaaccgggtgatacc
atccgggttgagcgagttccagacgggttagcctttgtcccggtcgtctcggcagaagta
gcatga

DBGET integrated database retrieval system