KEGG   Anaerolinea thermophila: ANT_14120Help
Entry
ANT_14120         CDS       T01410                                 

Definition
(GenBank) major facilitator superfamily transporter
Organism
atm  Anaerolinea thermophila
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NITE: 
UniProt: 
Position
complement(1575661..1576899)
Genome map
AA seq 412 aa AA seqDB search
MSFSLKQILGLSEPFPEEHRENFIHLFFDIAWWGVLNGSIIVFLAVYASRLGASSFQIGI
LTASPALMNILMTFPTNFFVRGKSTFQVVRWSALFTRLFYAFLIPLPILFPAQVQIWTII
VITLIMNIPGTIAAVMGNAFLAEGIPMEWRGQIIGIRNALLALTSMITSFIVGQVLKVFP
FETGYMIVFGLGWLGSMLSAYHLFKVKVVAPQTSPQSSQAQKPSWREIIRPDVLSGSFRN
VLLVMFFFHVAVFLPNPIFPLYQVNELKLTDETIGFGTSLFWILYFLTSTQVGGLSRKYG
FKTLTGAGTIIASFATLIFTFSYQVWIYVITQIVSGIGWAIIGGGLVNYVLVNVPPDDRP
SYLAWFNLAVNFAVLICGLVAPLITANLGLFGSMVLAVLVRFLAGIAILRWG
NT seq 1239 nt NT seq  +upstreamnt  +downstreamnt
atgtccttctcactcaaacagattttaggcttaagcgaaccctttccggaagaacatcgc
gaaaactttattcatctctttttcgatattgcatggtggggtgttctcaacggaagtatc
attgtgtttcttgcagtgtatgcctcccggttgggcgcttcgtcgtttcagattggaatt
cttaccgccagccctgcattgatgaatattctgatgacttttcctacgaacttttttgtt
cgcgggaaatccacctttcaggtagtacgctggtccgcattatttacccgtctattttac
gctttcctgattcctctccccatcctttttccggcgcaagttcaaatctggacaatcatt
gtcattaccctgatcatgaacatcccagggacaattgcagccgtcatgggaaatgctttt
ctcgcagaaggcattcccatggaatggcgaggacagatcatcggaattcggaatgctttg
ttggcgcttacttccatgattacttcgttcattgttggacaggtgctcaaggtatttcct
tttgaaaccggctacatgattgtttttgggctgggatggcttggttccatgctcagcgcc
tatcatctctttaaggtgaaagtagtcgctccacaaacatccccccaatcttcccaggca
caaaagccttcatggagagagattattcgtccggatgtgctttcaggttcctttcgaaat
gtactcctggtaatgttcttcttccatgtcgctgttttcttgcccaatcccatctttcca
ctctaccaggtcaatgagttgaaactgaccgacgaaactattggttttgggacgagttta
ttctggattctctactttcttacatccacacaggttggcggattgtcccgtaagtatgga
ttcaagacattgaccggtgctgggacaattattgccagttttgcaacattgattttcact
ttcagttatcaggtatggatttatgtaatcacacaaattgtaagtggaatcggatgggca
atcattggagggggactggtcaattacgtgctggtaaatgtgccccccgatgatcgccca
tcttatctggcatggttcaatttagccgtgaactttgccgttctaatatgtggtctagta
gcccccctgattaccgcgaatcttggtctatttggaagtatggtattagccgtactggta
cgctttctggctgggatagccatcctgcgatggggttga

DBGET integrated database retrieval system