KEGG   Anaerolinea thermophila: ANT_14130Help
Entry
ANT_14130         CDS       T01410                                 

Definition
(GenBank) hypothetical protein
Organism
atm  Anaerolinea thermophila
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NITE: 
UniProt: 
Position
1576981..1577982
Genome map
AA seq 333 aa AA seqDB search
MRVTIYLLLLFNLWLVSCSMATPRVSMPSHSEQPTAKTIPVDQKSSFILPTELTYQAETY
SSRQEAVSEGMRISPRDHLPCDRAEAGAPIDVTVPDDFAFLAGERFVKVWKLRNAGSCSW
TSDYSVVWFSGAPLGLQTSERLKQVVAPGEEVEIAVEMMAPDVPGVYQSHWKMQNARGQL
FGIGPEGESPFWVRIQVLPRPTSTPEAMVTPFVPTPGIYRLGSFELSPGDSLDLDSGLFN
PEQGGDFVFEILDGNYWIKPQGNSYLAVTSLFSPGYQDCRLAVLAQEAILATQEIQGSFM
CLRTNEGRLGSILLSLDFERNQLSGAYILWELP
NT seq 1002 nt NT seq  +upstreamnt  +downstreamnt
atgagggttacaatttaccttcttttgctattcaacctgtggctggtgagttgttcaatg
gcgaccccccgtgtttcaatgccatcacactctgagcagccaacggcaaaaacaatccct
gttgatcaaaaatcctcctttattctaccaacggagttaacataccaggcagagacttat
tcatccaggcaggaagcggtgtctgagggtatgcgaatctccccacgagatcaccttcct
tgcgatagggcggaagcgggtgctccgattgatgtaaccgttcccgatgacttcgccttt
ttagcgggagagcgtttcgtcaaagtttggaaactgcgtaatgcgggtagttgttcctgg
acttcggattattcggtagtgtggttttcgggtgcccctttgggactccaaacgagcgaa
aggctgaagcaagtcgttgcgccgggagaagaagtcgaaattgctgttgaaatgatggcg
cccgatgtacccggggtgtatcaaagccattggaaaatgcaaaatgctcggggacagttg
tttggaataggccctgagggagaatcgccgttttgggttagaattcaagttctccctcgt
ccaaccagtacccctgaagcaatggttactccgtttgttcctacaccggggatatatcgt
ttaggaagttttgaattaagccctggcgattccctggacctggattctggtttgtttaac
cctgaacaaggcggggattttgtttttgagatattagatggaaattactggattaagccg
cagggaaattcttacttagcagttacttcccttttctctccaggttatcaggattgccgt
ctggcagtactcgctcaggaagccattctggcaacacaagagattcagggtagtttcatg
tgcttaagaacgaatgagggaagactagggagtatcctgctttcgcttgattttgagcgc
aatcaattgtctggggcatacattctctgggaactcccctga

DBGET integrated database retrieval system