KEGG   Anaerolinea thermophila: ANT_14140Help
Entry
ANT_14140         CDS       T01410                                 

Definition
(GenBank) hypothetical protein
  KO
K07056  16S rRNA (cytidine1402-2'-O)-methyltransferase [EC:2.1.1.198]
Organism
atm  Anaerolinea thermophila
Brite
Enzymes [BR:atm01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.198  16S rRNA (cytidine1402-2'-O)-methyltransferase
     ANT_14140
Ribosome biogenesis [BR:atm03009]
 Prokaryotic Type
  rRNA modification factors
   16S rRNA modification factors
    ANT_14140
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TP_methylase
Motif
Other DBs
NCBI-ProteinID: BAJ63442
NITE: ANT_14140
UniProt: E8N4S8
Position
1577991..1578833
Genome map
AA seq 280 aa AA seqDB search
MGILYLVATPIGNLEDITLRALRVLREVSLVAAEDTRQTKKLLTHYGIDKPLISYYEHNK
LSRLQVILSHLQEGDVALVSDAGTPGLNDPGYELVKSAIEHGFRVYPVPGPASPIAALVG
SGLPTDAFLYLGYLPRKQKDRRERIAQIRDEPYTVLFLETPHRLRDSLKDLLDILGNRSA
VIARELTKIHEEFLRGTLHDLIQHFDQTEPLGEFVVLVAGASKLEKTWNEEQVLEVFQRE
FTGNISLKTFAEQLAQVSGWKKNDLYRLFLEQKKNQGTIK
NT seq 843 nt NT seq  +upstreamnt  +downstreamnt
atgggcatcttatatcttgtcgctacaccgattggcaatcttgaagatattacgcttcga
gcgttgcgggtacttcgagaagtctctctcgttgctgctgaagatacacgtcaaactaaa
aaacttcttactcattatgggatagataaaccgctaatcagttattacgaacataataaa
ttatctcgtcttcaggtcattttatcgcatctccaggaaggagatgttgctctggtctca
gatgctggcacacccgggttaaatgaccctggctatgaattggtaaagtcagccattgag
cacgggtttcgtgtgtatcctgtgccaggacctgcctcgccaattgcagccctggttggt
tctggattgcctacggatgctttcctgtatctggggtatcttccacggaagcaaaaggac
cgcagagagagaattgctcaaatccgcgatgaaccttacacagtattgtttctggaaact
ccacaccgtttacgggactccttaaaagaccttctggatattctgggtaaccgttcagca
gtcatcgccagagaattgacaaagattcacgaggagtttctgcggggaacattgcatgat
ctcatacagcattttgaccagactgagccgttgggagaattcgtcgttctggtggctggg
gcatcaaaactggagaagacatggaatgaagaacaggttctggaggtgtttcagcgggaa
tttacgggtaatatttccttgaaaacctttgctgaacaattagcacaggtttcggggtgg
aagaaaaacgacttatatcggttattcctggaacagaaaaagaatcaaggtacaatcaaa
taa

DBGET integrated database retrieval system