KEGG   Anaerolinea thermophila: ANT_14160Help
Entry
ANT_14160         CDS       T01410                                 

Gene name
tdk
Definition
(GenBank) thymidine kinase
  KO
K00857  
thymidine kinase [EC:2.7.1.21]
Organism
atm  Anaerolinea thermophila
Pathway
Pyrimidine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:atm00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    ANT_14160 (tdk)
Enzymes [BR:atm01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.21  thymidine kinase
     ANT_14160 (tdk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NITE: 
UniProt: 
Position
1579924..1580496
Genome map
AA seq 190 aa AA seqDB search
MKHTTGSIEVITGSMFSGKTDELIRRLRRARIARQKVQVFKPIIDDRYSVEKVTSHAGNE
FEAYPISRSEEIWQKLDPEASVVAIDEAQFFDEGIVGVVQALASKGVRVIVAGLDMDFRG
EPFGVMPVLMAIAERVDKLQAICMVCGEPASRTQRLVNGKPAKYSDPVVIVGASELYEAR
CRQHHEVPKE
NT seq 573 nt NT seq  +upstreamnt  +downstreamnt
ttgaaacatacaacaggttcaattgaagtgattaccggatccatgtttagcggtaaaacc
gatgagttaattcgtcgcttgagacgtgctcgcattgcccgtcaaaaggttcaggttttc
aagcccatcatcgatgaccgttatagtgtggaaaaagtcacttctcatgccggaaatgag
tttgaggcgtatccgatttcccgctccgaggaaatctggcaaaaattagatccagaggct
tcagtggttgcgattgatgaggcgcaattcttcgatgaagggattgtgggtgttgtacaa
gccttagcctcaaaaggggttcgtgttattgttgccggattggatatggatttccgtggc
gaaccgtttggtgttatgcctgtgttgatggcaattgctgagcgggtagataaactacaa
gccatttgtatggtttgcggtgagccagccagtcgtactcaaagactggtgaatggcaaa
ccggcaaaatattctgaccctgtggtgatagtaggcgcgtctgaattgtatgaagcccgt
tgcagacaacaccacgaggttcccaaagagtga

DBGET integrated database retrieval system