KEGG   Anaerolinea thermophila: ANT_14220Help
Entry
ANT_14220         CDS       T01410                                 

Definition
(GenBank) response regulator receiver protein
Organism
atm  Anaerolinea thermophila
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NITE: 
UniProt: 
Position
complement(1584098..1584514)
Genome map
AA seq 138 aa AA seqDB search
MDQEKRMKILIIDDDPGMTDLLSVLLAPSGAETLVANTALDGLELARFGQPDVIILDLLM
PEMNGVEVCKKIREFSAVPILVVSALDSPKVIAQVLDSGADAFLSKPISSAILMAQINKL
LRRASLVKKSLTKPGLTT
NT seq 417 nt NT seq  +upstreamnt  +downstreamnt
atggatcaggaaaaacgcatgaagatcctcatcattgatgatgaccctggaatgaccgat
ttgctctctgttctacttgccccatcgggagcagaaaccctggtagccaataccgccctt
gatggtttggaattagctcgattcgggcaacctgatgtgattattctcgacctgctcatg
cccgaaatgaacggagtggaagtttgcaagaaaatcagggagttcagcgctgtgcccatt
ctggtagtttctgcactggactcacctaaagtgattgcccaggtccttgacagtggggca
gacgctttcctgtctaaacccatttcaagcgccatcctcatggctcaaatcaacaaattg
cttcgaagagcctctctggtaaaaaaaagcctcaccaaaccaggactaactacataa

DBGET integrated database retrieval system