KEGG   Anaerolinea thermophila: ANT_14230Help
Entry
ANT_14230         CDS       T01410                                 

Gene name
ppdK
Definition
(GenBank) pyruvate, phosphate dikinase
  KO
K01006  pyruvate, orthophosphate dikinase [EC:2.7.9.1]
Organism
atm  Anaerolinea thermophila
Pathway
atm00620  Pyruvate metabolism
atm01100  Metabolic pathways
atm01120  Microbial metabolism in diverse environments
atm01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:atm00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    ANT_14230 (ppdK)
Enzymes [BR:atm01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.9  Phosphotransferases with paired acceptors
    2.7.9.1  pyruvate, phosphate dikinase
     ANT_14230 (ppdK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEP-utilizers_C PPDK_N PEP-utilizers DUF3788
Motif
Other DBs
NCBI-ProteinID: BAJ63451
NITE: ANT_14230
UniProt: E8N4T7
Position
1584713..1587412
Genome map
AA seq 899 aa AA seqDB search
MTQKKWVYVFNELDQASAYVGGSWDAVRGLLGGKGANLFEMYRIGLPVPPFFTVTTEACN
AYLASGEKFPEGMWEQELDALHKIEEASGKKFGDPSNPLLVSCRSGAKFSMPGMMDTVLN
IGLNDETVQGMIKLTNNPRFVYDSYRRLIMMFGAVVLGLPDEAFEEPMEAFKHQKGAKAD
TDLTAEDLKELSEIFKKVVRENKGFDFPQDPIEQLRLATEAVFKSWNGKRAIDYRRAEGI
PDNLGTAVNIVTMVFGNMGWDSGTGVAFTRNPSTGERKVFGEYLLNAQGEDVVAGIRNTD
PIEKMAETLPEAYNEFMKICEILEKHYRDMQDMEFTIERGKLWMLQTRNGKRTAKAAIKI
AVDMANEGLISKEEAVMRVSTKQVDAMLHPQFDENARKAAKKEGRLFATGVNASPGAAVG
QVFFDADTAEKKGKEEGLQVIMVRPFTKPDDVHGMLAAKGILTSEGGATSHAAVVARQFG
VPCVVGASAIRIDLEKRQMKVGDVVVKEGDWISLDGATGEVFLGKLDLTVPNLEEQQDLL
TLLNWADEIARLQVWANADYPKDARRARSYGAKGIGLCRTEHMFFEPERLPIVQRMILAE
TIEERKKALDELLPFQRSDFEGLFEAMDGYPVIIRLIDPPLHEFMPDEEKLFEEVITMRV
KGETKGLAEKEKLLASIRAMHESNPMMGLRGVRLSIYMPEIVEMQVRAIFEAAANCTLRG
VKVKPEVMIPLTGTVKELEWIQPRLERIAKQVMSEKGVNFPYKFGTMIEIPRAAVTAGEI
ARLAEFFSFGTNDLTQMTFGYSRDDAERNFLIKYVEEGILEKNPFQTLDREGVGRLMRMA
VEEGRRTRPELEVGICGEHGGDPDSIEFCHLIGQNYVSCSPFRVPVARLAAAQAAIKNR
NT seq 2700 nt NT seq  +upstreamnt  +downstreamnt
atgacgcagaagaaatgggtatatgtgttcaatgaactggaccaggcatctgcctatgta
ggtggttcctgggacgctgtgcgaggtttgctgggtggtaaaggagcaaacctgtttgaa
atgtatcgtattggcttgcccgttcctcccttttttacagtcaccactgaggcttgtaat
gcctatttggcgagcggggaaaaattccccgagggaatgtgggaacaggaactcgatgct
cttcacaaaattgaagaagccagcggcaagaaatttggcgatcccagcaatcctttgctg
gtatcctgccgttctggtgcaaaattctctatgcccggcatgatggacacggttttgaac
atcggcttgaacgatgaaaccgtgcagggcatgatcaaattgaccaataacccgcgcttt
gtgtacgattcctaccgccgcctgatcatgatgtttggcgctgtggtgctgggattgccc
gatgaggcttttgaagagcccatggaagccttcaaacatcaaaaaggcgctaaagccgat
accgatttgaccgctgaagatttgaaagaactttcggaaatcttcaagaaggttgttcgc
gagaataagggctttgatttcccccaggatcccattgaacaactgcgtttggcgacggaa
gcagtcttcaagtcctggaatggcaagcgtgccattgattaccgccgcgctgagggcatc
cctgataatctgggaacggctgttaacatcgtgacgatggttttcgggaacatgggatgg
gactccggtaccggtgtggcattcacccgcaatccttccactggcgagcgcaaggtcttc
ggcgagtatctgctgaatgctcagggtgaggatgtggtggctggtatccgcaacaccgat
ccgattgagaagatggctgagactctccccgaagcctacaacgaattcatgaaaatttgc
gaaatcctcgaaaagcattaccgcgatatgcaggacatggaatttaccattgagcgcggt
aaactgtggatgctccagacccgcaacgggaagcgcactgccaaagcggccatcaagatt
gctgtggatatggcgaatgaggggttgatttccaaagaagaggctgtgatgcgcgtttct
accaaacaggtggatgctatgctccacccgcagtttgatgagaatgcgcgcaaagccgcc
aagaaagagggacgcctctttgccactggtgtgaacgcttcaccgggcgcggcagtcggt
caggtgttcttcgacgccgataccgctgagaagaaaggcaaagaagagggcttgcaggtt
attatggttcgccccttcaccaaacccgatgatgtccatggtatgcttgccgctaaagga
attctgaccagcgagggtggtgctacttctcacgcggcggtagtggctcgccagttcggc
gttccctgcgttgttggtgcttctgcaatccgaattgaccttgaaaaacgccagatgaaa
gttggcgatgttgtggtcaaagaaggtgattggatttcgctggacggtgccacgggtgaa
gtcttcctgggcaaactggatctcactgtgcctaacctggaagaacagcaggatttgctc
actctgttgaattgggcagatgaaattgcccgtctgcaggtttgggcgaatgctgattac
cccaaggatgctcgccgtgcccgttcttatggtgcaaagggtattggcttgtgccgcacc
gagcacatgttctttgagcctgaacgtctgcccattgttcagcgcatgattctggctgag
accatcgaagaacgcaagaaggctttggatgaacttttgcccttccagcgttcggacttt
gaaggtttgttcgaagccatggacggatatcctgtgattatccgcctgattgacccgccc
ctgcatgagttcatgcccgatgaagagaaactctttgaagaagtgattaccatgcgggtg
aaaggcgaaaccaaaggactggcagaaaaagaaaaactgcttgccagcatccgtgccatg
catgaaagcaacccgatgatgggcttgcgcggtgtgcgcctgagcatttacatgcctgaa
atcgtggagatgcaggtgcgtgcaatctttgaggctgcggcgaattgcacactgcgcggt
gtcaaagtgaaacctgaggtgatgatccccctgaccggcacggtgaaggaactggaatgg
atccagccgcgtctggagcgcattgccaaacaggtcatgagcgaaaagggtgttaacttc
ccctacaagttcggcaccatgattgagattccgcgcgcggcagtcactgcgggtgagatc
gctcgcctggctgagtttttctccttcggtaccaacgacctgacccaaatgacctttggt
tacagccgggacgatgccgaacgaaacttcctcatcaagtatgttgaggaaggtattttg
gagaagaaccccttccagactttggaccgtgaaggtgtaggacgcctgatgcgcatggct
gtagaagaaggccgccgcactcgtccagaactcgaagtgggtatttgtggcgaacatggt
ggtgatcctgattctattgagttctgccacttgattggacagaactacgtgagttgttca
ccgttccgtgttccggtggcgcgtctggctgctgcgcaagcggcaatcaagaatcggtaa

DBGET integrated database retrieval system