KEGG   Anaerolinea thermophila: ANT_14240Help
Entry
ANT_14240         CDS       T01410                                 

Definition
(GenBank) putative permease
Organism
atm  Anaerolinea thermophila
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NITE: 
UniProt: 
Position
1587527..1589098
Genome map
AA seq 523 aa AA seqDB search
MASQSSERSSNLRVLDSFLILFLAVASIGVFVVGLIPYATLMGDFPGTNLTLALVIAAVL
GLLFVYIYSSIGAFFPHCGADYVLMSRVLTGSLGFAASLTMLVGATMLVSSFTGTLATVG
FPFISKTAEITAGAGFTVIENLHTPTGIMIVGSILIVLAFIVSIFPVRIVQNFLRFGFFL
TLLSWAGLIFQFAVPMYPLSDGWNTFMGFGAFDRQIFLARQLGLSTGPFPNAFLTLGLVI
TAILFAGIVMPVWMAGEVKNPKKDLFAGNVGAVLLASLIFIVTSLLFLRVSSSSWLAAQS
YLYLLTEDGKETVYPWLFFYANILRPNPTLAYLFLSGWLFSTFNLILVAIMAGSRMLMAW
AKDKILPVSFSFTHSGLGTPVVSLLWMSLLLEVGLMVFALAHTHNIEWIKPFFFVIASGQ
VVSAIALAVYPFKHPEDFQQTSGMAGWRIGKIPLVSVVGVIWVVYGVYLLNYLAINPRGF
DFRPFGWILGSFAVGFAFYSFRKNRLKTQGVDLDVLLTHSPEE
NT seq 1572 nt NT seq  +upstreamnt  +downstreamnt
atggcgagtcaaagctcagagcgatcgtcaaatttgcgtgtgctggatagttttctcatt
ctcttcctggcggttgcttcgattggtgtatttgttgtagggttgattccttatgctacc
ttaatgggtgattttccaggcaccaacctcacgcttgctctggttattgcggcggtttta
ggccttttgtttgtttatatttattcctcaattggggcatttttccctcactgtggcgct
gactacgtgttgatgtctcgtgtcttaaccggttctctgggttttgcagcgtcccttact
atgctggttggcgctaccatgctggtaagcagttttacaggcactcttgctactgtaggg
ttccctttcatctcaaaaacagcagaaattacagccggcgcaggttttactgtcatagaa
aatttgcatacgcccactggaataatgattgtaggctcgatcttgattgtactggcgttt
attgtcagtattttcccggttcggattgttcaaaatttccttcgctttgggtttttcctc
accctattgagctgggcgggtttaattttccagtttgcagttccaatgtatccactctct
gatggatggaatacatttatgggatttggtgcttttgaccgccaaatatttctagcccgt
caacttggattatctactgggccatttccaaatgcatttcttactcttggcttagttatc
accgccattttatttgccgggattgttatgccagtgtggatggcaggggaggttaaaaat
cccaaaaaagacttgtttgcaggaaatgtgggagcagttcttctggcttctctcattttt
atcgtcaccagtttattgtttttgcgtgtgtcgtcttcgtcctggcttgccgctcagagt
tatttatatctgttaacagaggatggaaaagaaactgtctatccatggctattcttctat
gctaatattcttcgacctaaccctacattagcctatctctttttgtcaggctggttgttt
tctaccttcaacctgatccttgtcgcgattatggctggctcaagaatgttgatggcgtgg
gcaaaagataaaattttgccagtttcgttttccttcactcactccgggcttggtactccg
gttgtctctcttctctggatgtccttgcttttggaagtggggttaatggtttttgcgctt
gctcatactcataatatcgagtggatcaagccatttttctttgtgattgcttccggacag
gtggtctcagcaattgccctggcagtttaccctttcaagcatcctgaagattttcagcag
acttcaggcatggcagggtggcgaattggaaaaattccgctcgtgagtgttgtaggggtg
atctgggtggtttatggggtctatttattgaattaccttgcaattaatcccagaggattt
gatttcagaccgtttgggtggatattaggctcttttgcagtaggatttgccttttactcg
ttccggaaaaaccgcttgaaaacgcaaggtgttgatctggatgttttattgacccattca
cctgaagagtag

DBGET integrated database retrieval system