KEGG   Anaerolinea thermophila: ANT_14280Help
Entry
ANT_14280         CDS       T01410                                 

Gene name
pdhC
Definition
(GenBank) putative pyruvate dehydrogenase E2 component
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
atm  Anaerolinea thermophila
Pathway
atm00010  Glycolysis / Gluconeogenesis
atm00020  Citrate cycle (TCA cycle)
atm00620  Pyruvate metabolism
atm01100  Metabolic pathways
atm01110  Biosynthesis of secondary metabolites
atm01120  Microbial metabolism in diverse environments
atm01130  Biosynthesis of antibiotics
atm01200  Carbon metabolism
Module
atm_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:atm00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    ANT_14280 (pdhC)
   00020 Citrate cycle (TCA cycle)
    ANT_14280 (pdhC)
   00620 Pyruvate metabolism
    ANT_14280 (pdhC)
Enzymes [BR:atm01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     ANT_14280 (pdhC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 HlyD_3 RnfC_N GCV_H HlyD_D23 QRPTase_N TetR_C_2
Motif
Other DBs
NCBI-ProteinID: BAJ63456
NITE: ANT_14280
UniProt: E8N4U2
Position
1592065..1593348
Genome map
AA seq 427 aa AA seqDB search
MAETIKMPKLGFDMQEGTLVRWVRQEGEAVEKGQVLAEIETDKATVEVEASVSGIVHRHL
VEQGAVVPVGTPIAIIAAPGETVAEEPVAGVLPAKNVEEAAEKEAVSLAQPSVSGEEQRI
KASPLAKRLAKEHQVDLNAVQGSGPGGRIVRKDIEAYLAMIRTAVPQAVEVPIPTPSVST
SPAPSSGFTLPVWTAPESVPADETVPMDRLRQAIGRRMVDSKQNYPHFYITRSFNVEALM
ALREQINQVMPEGQKLTLNDFVIKAVALALRSYPNLNASISGNAILRHGRVNIGVAVAVE
GGLLTVVCKDADQKPLRVISSEIRDMVSRARQGKVRPEDIEGSTFSISNLGMFDVENFMA
IINPPESGILAVGAAQKVPVVVGDEIKTGLRMKATLSADHRVTDGAEAAQFMQVLARYLE
NPILLLV
NT seq 1284 nt NT seq  +upstreamnt  +downstreamnt
atggctgagaccattaagatgcccaaattgggctttgacatgcaggaagggacactggtt
cgttgggtcaggcaagaaggcgaagccgttgaaaaaggacaggtgctggcagaaattgaa
acagataaggcaactgtcgaggttgaagccagtgtgagcggaattgttcatcgtcatctg
gtagagcaaggggctgttgttccggttgggacgcctattgccattattgcggcccccggc
gaaacggttgccgaagagccggtggcaggtgttttgcctgctaaaaatgtagaggaagcg
gctgaaaaagaagccgtttctctggcacagccatctgtcagtggtgaagagcaacgcatc
aaagcctcgcctttagccaagcgtctggcaaaagagcatcaggtggacttgaacgcggtg
cagggaagtggccctggtgggagaattgtgcgtaaagatatcgaagcctacctggcaatg
ataagaacggcggtgccccaggctgtggaggtaccgattccgactccctctgtgtctaca
tcaccagccccttcctcaggttttactctaccggtatggactgccccggagagcgttcca
gcggatgagactgttcccatggatcggttgcgccaggcgattgggcgtcgtatggtggat
tcaaagcagaactacccgcatttttatattactcgttcgttcaatgttgaagccctgatg
gctttgcgagagcaaattaatcaggttatgccagaagggcaaaaattaacgctgaacgat
tttgtgatcaaggcggttgcattggctttgagaagttatcctaacctgaacgcttcgatt
tccgggaatgccattctccgacatggacgcgtgaatattggggtggcagtggccgtagag
ggtggtttgctcactgtggtatgtaaagatgcggaccagaagccattgagagtcatttct
tcagaaattcgggatatggtttctcgtgccagacagggaaaagtacgccctgaggatatt
gagggctcgactttttctatcagcaaccttggcatgttcgatgtcgaaaactttatggcg
attattaatcccccagaaagtggtattcttgcagtgggagcggctcaaaaagtgccggtt
gtggttggcgacgaaattaaaaccggtctccggatgaaagctaccctttcggcagatcat
cgcgtgaccgacggtgctgaagccgcgcagttcatgcaggtactggctcgttatctggaa
aatcctatcttgcttctggtttag

DBGET integrated database retrieval system