KEGG   Anaerolinea thermophila: ANT_14290Help
Entry
ANT_14290         CDS       T01410                                 

Definition
(GenBank) hypothetical protein
  KO
K08309  soluble lytic murein transglycosylase [EC:4.2.2.-]
Organism
atm  Anaerolinea thermophila
Brite
Enzymes [BR:atm01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.2  Acting on polysaccharides
    4.2.2.-  
     ANT_14290
Peptidoglycan biosynthesis and degradation proteins [BR:atm01011]
 Peptidoglycan biosynthesis and degradation
  Lytic transglycosylase
   ANT_14290
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TPR_2 TPR_16 SLT TPR_6 TPR_1 TPR_8 TPR_14 TPR_21 TPR_9 TPR_12 YfiO TPR_17
Motif
Other DBs
NCBI-ProteinID: BAJ63457
NITE: ANT_14290
UniProt: E8N4U3
Position
complement(1593404..1595923)
Genome map
AA seq 839 aa AA seqDB search
MAFGKPALYWKNFLALSGFSPSIDIPLHFQYKHQYMFKKPLAVILLFSFLIISCGIPLQV
GQQISLETPTANTALQPPTPEPSPTSSPTPLPSIRLELGESHLFMGDFDRAREEFQNILT
TTNDEKIQAEALIELGKTSYLSRNYEQAIKELTQGITQNPQSKNAGTAWLHLALSFEALN
KPDAASDAYAKLAEIIPPVLNDYIQEWRGDALLNAQRPAEAAQAYQMALDALPADTDAVW
LKIKKARALARAQDTSTAISEFLSAYESTSNQYAKAQINFLLGQIYLNLGVPEQAYARFQ
DSVTNYPMAYDSYSGLVELIKAGQPVDELNRGLVDYFAGQYGLAVEAFTRYIDSQEAPSS
TAFYYRGMSRFYMSEYGNAIADFDVIIEKNPNDRFWVKAYQQKAYILWAYLNDYQTAAQV
LMDYVNKAGDIEDAPQILFEAGRIFERGNYLTKAVETWQECHEKFPAAEISRRALFLAGI
TLYRLNDFSQSRLIFQRFLILSDNPEDQAAAYLWVGKTYQAENNLQQAKIAWEQAVQRDP
TGYYSQRASELLVGRSPFQSQNPINLAYDLNLEKEEAEAWLRTKFSIPPEVDLNDLSELR
LSPAFQKGTILLELGMYEYALREFEKVRQQYLNDPVNTYKLTNFFLEKNLYRLAILSARR
VLDLAGFDDASTLSAPRYFNHIRFGVYFKGLIQQAALKYNLNPLFLLSVIRQESLFDPAA
ISSANARGLMQIIPPTAQEIANQLQWPPNFDLQDLERPLVSIEFGASYLARQIRLFDGDL
YAALASYNGGAGNTLIWRELANNDPDLFLEVIRFDETRQYIMNIVELYNLYRLFYEQKP
NT seq 2520 nt NT seq  +upstreamnt  +downstreamnt
ttggcctttggcaaacccgctctttactggaaaaatttcctggccttatcaggattctcc
ccaagtattgacatccctttacacttccagtataagcaccagtatatgttcaagaaacct
cttgccgtcattttactcttctctttcctcattatttcgtgtggaattccacttcaggtt
ggacaacaaatctctttagaaacaccaacggccaacaccgctcttcagcccccaacccct
gagccaagtccaacctcttcgcccactcccctcccaagcattcgattggaactgggcgag
agccatctttttatgggagattttgatcgtgctagagaagagttccaaaacatcttaaca
accaccaatgatgaaaagatccaagcagaagccctgatcgaattgggaaagacatcttat
ctatcaagaaattacgaacaggctatcaaagaattaacgcagggaattacccaaaaccct
caaagtaaaaatgccggcactgcctggttacacctggccctttcatttgaagcccttaac
aaacctgatgcagcctctgatgcctatgcgaaattagcagagataattcctcctgtcctg
aatgactacattcaagaatggcgaggagatgccctcttgaatgcccaacgtccggcagaa
gctgctcaggcgtatcagatggctctggatgccttgcccgccgatacagacgcagtgtgg
ttaaaaatcaagaaagccagggctcttgcacgtgcccaggatacttcgacagcaatttct
gagttcttaagtgcctatgagagcacatccaaccaatacgctaaagcacaaatcaacttt
cttctgggacagatttatctcaatctaggcgtgccagaacaagcctatgcccgtttccag
gattcagtgacaaattacccgatggcttacgattcttattcggggttggtggaattaatc
aaggcaggtcaacccgtggatgagctaaatcggggattggtcgattactttgcagggcaa
tatggactggctgtcgaggctttcacacgttacattgatagccaggaagcacctagcagt
acggctttctactatcgtggaatgagtcgtttctacatgtcagaatatgggaacgcaata
gccgattttgatgtcattattgagaaaaatcccaatgaccgcttttgggtaaaagcctac
cagcaaaaagcctatattttatgggcatatctgaacgactatcaaactgctgcccaagtt
cttatggattatgtgaacaaagccggggatatcgaagatgccccacaaatcctttttgag
gcaggcagaatattcgaaagaggaaattacctcactaaagcggtggaaacctggcaggaa
tgtcacgagaagtttccggcagcagaaatcagccgacgtgcgttatttcttgctggaatt
accctttaccgcttgaatgatttttcccaatcccgtttaatttttcaacgctttttgatt
ctttcggacaatcctgaagatcaagccgcggcttatttatgggtcggaaaaacctatcag
gcagaaaacaatcttcaacaagcaaaaattgcgtgggaacaggctgtacagagagatccc
acgggatactacagccagcgagcttcagaacttctggtgggacgatctcctttccaaagc
caaaatccaatcaatttggcttacgacctgaatctggaaaaggaagaggcagaagcctgg
ctgagaacgaaattttccattccacccgaggtggatttgaacgatttatctgaactgcgc
ttatcgccggccttccagaaaggcacaatcctccttgaattgggaatgtacgaatacgcg
ctccgtgaatttgagaaagttcggcaacaatatctgaatgacccggtaaacacatacaaa
ctgaccaactttttcctggaaaagaacctgtaccggctagccattctctctgcaaggcgc
gtgctcgatttggctggttttgacgacgcatccaccctgagcgctccgcgctacttcaat
cacattcgatttggcgtgtatttcaaaggcctaattcaacaagccgcgcttaagtacaat
ttgaatcctttattccttctaagtgttattcgccaagaaagcctcttcgacccagcagca
atctcttctgcaaatgccagagggttgatgcaaattattccacccacggcacaggaaatt
gccaaccaactgcaatggccccccaactttgacttgcaagatctggagcggcctctggtt
tcgattgaatttggagcatcttacctggctcgtcagattcgtctatttgatggggacctg
tacgcagcccttgcatcttacaatggtggtgccgggaacacactgatctggagagaactt
gcaaacaacgatcctgatttatttctggaagtgattcggttcgatgaaactcgtcaatac
atcatgaacattgtcgaactttacaatctataccgtctgttttatgaacaaaaaccctga

DBGET integrated database retrieval system