KEGG   Anaerolinea thermophila: ANT_14400Help
Entry
ANT_14400         CDS       T01410                                 

Definition
(GenBank) F420-dependent NADPH reductase
  KO
K06988  
8-hydroxy-5-deazaflavin:NADPH oxidoreductase [EC:1.5.1.40]
Organism
atm  Anaerolinea thermophila
Brite
Enzymes [BR:atm01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.40  8-hydroxy-5-deazaflavin:NADPH oxidoreductase
     ANT_14400
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NITE: 
UniProt: 
Position
1605519..1606196
Genome map
AA seq 225 aa AA seqDB search
MESPEQTIAIIGGTGKEGKGLAYRWAKAGYTVLIGSRVREKALATVAELRERLGEAVRME
GMTNQEAAEKADIVVLTVPYAAHQETLLTIKDQVQGKILIDVTVPLMPPKVTRVHIPPAG
SAAQEAQNILGPDVQVVSAFQNISYEHLLNDHEIECDVLVCGGTRAARAEVIKLVEAAGL
TGWDAGPIENSIVAEGLTSILIGINKQYGVESAGIRITGVQRKKE
NT seq 678 nt NT seq  +upstreamnt  +downstreamnt
atggaatcaccagaacagacgattgcaatcattgggggaacaggaaaagaaggcaaaggc
ttggcgtatcgctgggcaaaggctggatatacagtcttaattggttcacgggttcgggag
aaagccctggcgaccgtggcggaattaagagaacggttgggtgaagcggttcgcatggaa
ggaatgaccaatcaggaagccgccgaaaaggcagatattgtggtgttgacagtgccttat
gcagcacatcaggagacgctgcttactattaaagatcaagttcagggcaagattttgatt
gatgtgaccgtgcccctgatgcctcctaaggtgacccgcgtgcatattcctccggcaggc
agtgccgctcaggaagcgcaaaatattcttggaccggatgttcaggtggtctctgctttc
caaaatatttcctatgaacatttactcaatgatcatgaaattgagtgtgatgtgcttgtc
tgtggtgggactcgagcggctcgcgcagaggtgattaaactcgtagaggccgccggtttg
actggatgggatgccggcccgattgagaattctatcgtggctgagggactcacctccata
ttgattggaattaacaagcaatatggggttgagtctgctggtattcgcattacaggtgta
caacgaaagaaggagtaa

DBGET integrated database retrieval system