KEGG   Anaerolinea thermophila: ANT_14420Help
Entry
ANT_14420         CDS       T01410                                 

Definition
(GenBank) hypothetical protein
Organism
atm  Anaerolinea thermophila
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2_5_RNA_ligase2 SH3_7
Motif
Other DBs
NCBI-ProteinID: BAJ63470
NITE: ANT_14420
UniProt: E8N4V6
Position
1606974..1607522
Genome map
AA seq 182 aa AA seqDB search
MFFAVVSLLALENNPAFSEVWTRLKKIFSRYGLELVERPHISWHVSPVYDMEKLEKNLQG
LTQGRRQIRASISGLGVFTGKKPVFYLPVVRSPQVHEIHRTIWAEISPCALNQELYYSPE
EWIPHITLNRKAFSCNVGEVFQELCSLDLRCEVWLDNFAVIYRDDAHDGVGTIFPFSKEK
SV
NT seq 549 nt NT seq  +upstreamnt  +downstreamnt
atgttctttgccgttgtctctctactcgctttagaaaacaacccggctttttccgaggtt
tggactcggcttaagaagatttttagcagatatggacttgagttggtggaaaggccgcat
atttcctggcatgtcagtccggtttatgatatggaaaagttagaaaagaatttacaaggg
ctgactcaagggcgcaggcaaatacgtgccagtatttcaggcttaggggtctttacggga
aagaagcctgttttttatttgcctgtagtgcgtagtcctcaagtgcatgagatacatcgc
accatatgggcagaaatttctccctgtgccttaaatcaggaattgtattactctccagag
gagtggatccctcatatcacacttaacagaaaggctttttcctgcaacgttggagaggtt
tttcaggaactttgctcgcttgacctgagatgtgaagtttggctggataacttcgctgtc
atatatcgggatgatgctcacgatggggttggcactatttttccctttagcaaggagaag
tctgtatga

DBGET integrated database retrieval system