KEGG   Anaerolinea thermophila: ANT_14470Help
Entry
ANT_14470         CDS       T01410                                 

Gene name
xdh
Definition
(GenBank) putative xanthine dehydrogenase
  KO
K12528  
putative selenate reductase molybdopterin-binding subunit
Organism
atm  Anaerolinea thermophila
Pathway
Selenocompound metabolism
Brite
KEGG Orthology (KO) [BR:atm00001]
 Metabolism
  Metabolism of other amino acids
   00450 Selenocompound metabolism
    ANT_14470 (xdh)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NITE: 
UniProt: 
Position
1610889..1613888
Genome map
AA seq 999 aa AA seqDB search
MQITLTINQQEKTFEIHPSDTLLKVLRREGYFSVKFGGCSEGECGSCTVLLDGIPVNSCC
MLAAQADGHVVETVEGLGEHPEHGWKTSRGLHPIQQAMVESGAIQCGYCTPAMVLAAKSL
LEKNPNPSETEVRDALSGILCRCTGYVKPVEAVLQAARYMRGEQPLSEENGDIIPVDWKT
TNPSPENPMSSEIPAVKTQTRITPKIWTHPDVVNTSVVGKPEKKVDAIKLVQGKPAFTDD
IEMRGMLVAKVLHSPVAHARIKHIDVSKARALPGVAAVLTWQDIPRVVYSTAGQSDPIPG
PLDTFSLDNKVRFVGDRVAFVAAETEEIAEKALQLIEVEYEELPAILDPALSMQPGAVQI
HDEPEYVNFADSDPARNLAAKIRIDIGNVEKGFAEADMIFEGDYEVPKVQQAHIEPHVVV
TYWDEDDRLVIRTSTQVPFHVRRILSPVLGLPVKRIRVIKPRIGGGFGGKQEVLIEDVAA
HLTIATGRPVRYEYTREEEFIAARSRHPMRIHMKTGVKRDGTITANEMYCLSDTGAYGCH
ALTVTGNTGHKAMALYVGDGVYRQSPNIRFYADVVYTNTPPAGAYRGYGVPQGYWAVERH
MEKIAHALQLDPIEFRLKNTLRAGELHPFSTAWSEGREPRPEVIHTVGLEECVRQGKSVI
GWDEKFGNPDWHAIPGHPELRRGIGVALVMQGTAIPYLDMGGASIKMNDDGSFNLLVGAT
DLGTGSDTVLAQMAAEVLGTSVENIIVYSSDTDFTPFDKGAYASSTTYISGTAVVKAAEQ
VAERIRIRAAEMLKQDEDIPPEKIRLADGKAIAPDGRYVTHQEVAYHTLHHQNQEQIMGV
ASYFSPVSPPPFAAQFAEVTVNVETGSVTVDRLVMAVDSGVIVNPVTASGQIEGGMAQAL
GYAVSEEMVYDKKGRARERDLRDYHIFRADEMPVMDTIFVQTYEPSHPFGAKAVAEIPMD
GVAPAVGNAVLDAVGVDIDANPITPEKVWRALRNKRING
NT seq 3000 nt NT seq  +upstreamnt  +downstreamnt
atgcaaatcaccttaaccattaatcagcaagagaagacatttgagattcatccttctgat
acgctcttaaaagttttgcgccgtgaaggatattttagtgtgaaatttggcggatgttct
gaaggggaatgtggctcgtgtactgtgctcctggacgggattccggttaattcatgttgt
atgcttgcagcacaggcggatggccatgttgtggagacggtggagggattaggcgagcac
ccagagcatggttggaaaacttccagaggacttcatcccattcaacaggcaatggttgaa
tcgggtgcgattcaatgtggctactgtactcccgcaatggtgcttgcggcaaaatcttta
ctggaaaaaaatcctaacccttcagaaacagaggtcagagacgccctttcaggaattctt
tgtcgttgtacaggatatgtgaagcctgtagaagccgtcctccaagcagcgcggtatatg
cgtggggaacagcctttatctgaagaaaatggcgatattatccctgttgactggaaaaca
accaacccgtcgccggaaaaccccatgtcttcggaaataccggcggtaaaaactcaaacc
cgtatcactcccaaaatatggacacatccggatgtcgtaaacacatctgtggtaggcaaa
ccagaaaagaaagtggatgccatcaaactggttcagggcaagccggcgtttacagatgat
atcgaaatgcgaggcatgctggttgctaaggttcttcacagcccggtggcacatgcaaga
atcaagcacatcgatgtctcgaaggctcgagccctgcctggggttgcggccgtgttgacc
tggcaagatattcctcgcgtggtttattctacagccggacagtctgaccctattcccggt
cccctggataccttttcgcttgacaataaagttcgctttgtaggggatcgtgtggcgttt
gttgctgcagaaaccgaagaaattgctgaaaaggctctgcaacttattgaagtcgagtat
gaagaactgcctgccattcttgaccctgccctttccatgcaacctggcgcggtgcaaatt
cacgatgaacctgaatacgtgaattttgctgattctgatcctgccagaaaccttgctgca
aaaattcgtattgatattgggaatgtggaaaaaggctttgccgaagccgatatgattttt
gaaggtgattatgaagtccccaaagttcagcaagcacatattgaaccccatgtagtggta
acgtattgggatgaggatgatcgtctggtcattcgcaccagcacccaggttcctttccat
gtgaggcggattctgtctccggtattggggttacctgttaagcgtattcgggtgatcaag
cccagaatcggaggcggttttggcgggaaacaggaagttctgatcgaagatgtagcggcg
catttgacgattgctaccggcagacctgttcgttatgaatatacccgcgaggaagaattt
attgcggctcgttctcgtcatcccatgagaatccacatgaaaactggggtgaagcgcgat
ggaacaattacggcaaatgagatgtactgtttgagtgacaccggcgcatatggatgccat
gccttaaccgtcactggaaacacagggcacaaagccatggcattatatgtgggcgatgga
gtgtatcgccaatcgcccaatattcgcttctacgcggatgtagtttatacaaatacgccg
ccggctggagcctatcggggatatggtgttccacaggggtactgggcggtagaacgccat
atggagaagattgcccacgcccttcaactggatcccattgagttccgtttgaaaaatact
ctccgtgctggagagttacatcccttcagcacagcatggagcgaagggcgggaaccccgt
cctgaggtcattcacactgttggtttggaagaatgtgtgcgtcaaggcaagtcggtgatt
gggtgggatgagaagtttggcaatccagactggcatgctattccagggcatccggaactt
cggcgcggtattggagtcgcgctggtcatgcagggaacagccattccttatctggatatg
ggcggtgccagtattaagatgaatgatgacggttccttcaatttgctggttggagcaacc
gatttgggcacaggctcagacacggttctcgcacaaatggcagcggaagttttaggtact
tcggtggagaatatcattgtgtattcttccgataccgactttactccctttgataaaggt
gcttatgcgtccagtaccacatacatttcaggaactgctgtggtgaaggcggctgaacag
gtggcggaacgcattcgcatccgtgccgcagagatgcttaaacaggatgaggatattccc
ccggagaagattcgacttgcagatggaaaagccattgccccagatggcaggtacgtcaca
caccaggaagttgcctatcatactttacaccaccaaaatcaggaacaaattatgggagtg
gcgtcatatttctcacctgtttcgcctccgccgtttgcggcacagtttgccgaggttacg
gtcaacgttgaaacgggatcagttactgttgaccgattggtgatggcggtagattcaggg
gtcatcgtcaatcctgtgacggcatctgggcagatagaaggcggaatggcacaggcttta
ggttatgctgtcagcgaggaaatggtctatgataagaaaggcagagcccgggagcgtgat
ttaagggattatcatattttccgggctgatgaaatgccggtgatggataccatttttgtg
caaacttatgaaccttcgcatccatttggcgcgaaggctgtagctgagattcccatggat
ggagttgcgccagccgtgggcaatgccgtgctggatgctgttggtgtggatattgatgca
aacccgattactcccgaaaaggtttggcgcgccttaaggaataaaagaattaatggttaa

DBGET integrated database retrieval system