KEGG   Anaerolinea thermophila: ANT_14480Help
Entry
ANT_14480         CDS       T01410                                 

Definition
(GenBank) XdhC_ CoxI family protein
  KO
K07402  
xanthine dehydrogenase accessory factor
Organism
atm  Anaerolinea thermophila
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NITE: 
UniProt: 
Position
1613907..1614695
Genome map
AA seq 262 aa AA seqDB search
MSVFQALAELESQGKGAVLCTVIRSAGSTPRHEGSKMIVYPDGHILGTVGGGELESRVIK
EALDVYQQGKPRLLSYSMVNPKEGDPGVCGGTVQIYVEPILPKPVLLVIGGGHVGKAVAH
LGKFLGFRVAISDDRPEFCNPEAIPDGDEFYPVPMRDLPQAMTITPQTYIVMTTRGSVVD
VPGLPALLDSPAAYIGIIGSKRRWLTTKKALLESGIAEEKIARVHSPIGLELNAETPEEI
AVSILAEIIMLRNGGTGERMRI
NT seq 789 nt NT seq  +upstreamnt  +downstreamnt
atgagcgtttttcaagccttagccgaattagagagtcagggaaaaggggcggtgctttgc
acagtcattcggagtgcaggatcaacaccgcgccacgaaggtagcaagatgattgtgtat
cccgatggacacattctgggaactgtaggtggtggcgaactggaaagccgtgtgattaaa
gaagccctggatgtgtatcaacagggaaagcccaggttgttgagttattcaatggtgaat
cctaaggaaggcgatccaggtgtttgtggaggaactgtgcaaatatatgtagaaccgata
cttcccaaaccagttttactggtaattgggggaggacacgttgggaaggctgtggctcat
ttaggaaaatttcttggttttcgcgtagccatatcggatgaccgccctgagttttgcaat
ccagaagccattcccgatggtgacgagttctatcctgttcctatgagagatctaccacag
gcgatgacgatcaccccacaaacatacattgtgatgacgacccgcgggagtgtcgttgat
gttccagggttgcctgcgttgcttgactctccggctgcttacatcggcatcataggctca
aaacggcgctggctgactacgaagaaagccttgctggaaagcggtattgcagaggaaaaa
attgcccgtgttcattctccgattggtttagaattaaacgcagagacccccgaagaaatt
gcagtaagcattttggctgaaattatcatgcttcggaatggcggtactggtgaaaggatg
agaatttaa

DBGET integrated database retrieval system