KEGG   Anaerolinea thermophila: ANT_14500Help
Entry
ANT_14500         CDS       T01410                                 

Definition
(GenBank) hypothetical protein
Organism
atm  Anaerolinea thermophila
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: EI24
Motif
Other DBs
NCBI-ProteinID: BAJ63478
NITE: ANT_14500
UniProt: E8N4W4
Position
1616119..1616511
Genome map
AA seq 130 aa AA seqDB search
MPKYGSYQSERDREEREQRRQIHPIWRGVGFAFLVLIPLLSYAAAEVFISWNTKSNQFPW
PYDLMARPGNFLYNGDPWLYYKAILTLAFMLVLYALFTFVTFLLNSAFAPPRYGPYDVPP
IKGRVRKRAR
NT seq 393 nt NT seq  +upstreamnt  +downstreamnt
atgcccaaatacggatcttaccaatcggagcgggatcgggaagaacgtgagcaaagaaga
caaattcatcccatctggcgaggagtaggatttgcctttctggtgctgatcccgcttctt
tcctatgctgcagccgaggtcttcatcagttggaataccaagtccaatcagtttccctgg
ccctatgatttaatggcacgcccggggaactttctttacaatggagatccctggctctac
tataaagcaatactcacactggcgtttatgctggtgctctatgcactttttacctttgtt
acttttcttttgaacagtgcattcgcgcctccacgatatggtccctatgatgttccccct
atcaaaggacgtgtgcgaaagcgtgcacggtag

DBGET integrated database retrieval system