KEGG   Anaerolinea thermophila: ANT_14530Help
Entry
ANT_14530         CDS       T01410                                 

Definition
(GenBank) hypothetical protein
  KO
K07141  
molybdenum cofactor cytidylyltransferase [EC:2.7.7.76]
Organism
atm  Anaerolinea thermophila
Pathway
Folate biosynthesis
Brite
KEGG Orthology (KO) [BR:atm00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    ANT_14530
Enzymes [BR:atm01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.76  molybdenum cofactor cytidylyltransferase
     ANT_14530
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NITE: 
UniProt: 
Position
1619611..1620234
Genome map
AA seq 207 aa AA seqDB search
MMTTKSIIGAVVLAAGMSRRMGQPKQLLPWGKTTVIGQVVNVLQAAQVAQIVVVTGKSRE
QVEQTLKNTSAQCVFNPRYETSEMLTSLKVGISRLHDEVQAVLVVLGDQPQIQVSVVQGL
IEQYRLGKGVLIVPSYQMRRGHPWLVDRSLWQEILQMDDERESMRNFLNHHAQDIVYYLV
DTPSILTDMDTPEDYQQMRPVDERDNE
NT seq 624 nt NT seq  +upstreamnt  +downstreamnt
atgatgacaactaaatcaatcatcggagcggtagtccttgcggctggaatgtctcgaaga
atgggacagcctaaacaacttttgccttggggaaagaccacggttatcggtcaggtggtg
aacgttttacaggcggcacaggtggcacagattgtggttgtcacgggcaaatcccgtgaa
caggttgaacaaactctgaaaaatacctctgcacagtgtgttttcaatccacgttatgag
accagcgaaatgttaacttcgttgaaagttgggatatcccgattacatgatgaggtccag
gctgtgctggttgtgctgggcgatcaacctcaaattcaagtttctgtggttcaggggtta
atagaacagtatcgccttggaaaaggcgtattaattgtgcccagttatcaaatgcggcgt
gggcatccctggttggtagataggagtctctggcaagaaattctccagatggacgatgaa
cgcgaaagcatgcggaattttctcaatcatcacgctcaggatattgtctattatttagtg
gatacaccttcaatcctgacagatatggatactcctgaggattaccagcagatgcgtcct
gtggatgagagggataatgagtaa

DBGET integrated database retrieval system