KEGG   Anaerolinea thermophila: ANT_14670Help
Entry
ANT_14670         CDS       T01410                                 

Definition
putative aldehyde ferredoxin oxidoreductase (EC:1.2.7.5)
Orthology
K03738  
aldehyde:ferredoxin oxidoreductase [EC:1.2.7.5]
Organism
atm  Anaerolinea thermophila
Pathway
Pentose phosphate pathway
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:atm01200]
Metabolism; Carbohydrate metabolism; Pentose phosphate pathway [PATH:atm00030]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NITE: 
UniProt: 
Position
1634643..1636475
Genome map
AA seq 610 aa AA seqDB search
MNNRLLFVDLTTGRIGCSTIPENYLKEYIGGSGLGVRILWDWLNPSTSPLDPSSPLLFIT
GPLTGANGPATGRFTVCGRSPQTGLWGEANIGGFVGPELRYAGFDAVLVTGKAPTPVYLW
IHQGDAQIRDASHLWGKTDIYETQVQIRQELEEPRARIACIGLAAENGVVFSGIFSDHGR
AAARTGLGLLMASKNLKALAVRGTQKIPLALPERFSEERIRVNKELANHNMTAVFRATGT
SGAAEYLQMLGDMPQKYWMGASFDGADKISGAQMAETILAGTAACQGCVISCGRVVSIPE
GPYQTNGKTKGPEYETICSFGSQLLVDDLAAITALGETCDRLGMDSISAGSVIGLAYLLF
ERGILTEKDTEGLTLQWGDPKPAFVFLEKMARRQGIGEWMAQGSRAFAARLGVEELAVQV
NGLDVAMHDPRAFSGQTLSYLTSPRGACHNQSDFFTVELGGTLDEIGIPMTDRFTDAGKA
KYVARHQHWRSVCNSLVMCFFASVSPKDVVDLLNLATGEEWTLDSLMTAGERIWNLKRLY
NLALGYSPDNEKLPALLLQALPDGGQGGFIPDVQTLKKEYYEACGWDQKSGMPGKEVIDR
LNLGFTKDKF
NT seq 1833 nt NT seq  +upstreamnt  +downstreamnt
atgaataatcggcttctctttgtggatttaacaaccggtcgaattgggtgctcaactatc
cctgaaaattacttgaaagaatacattggcggaagtggtttgggggtcagaattctctgg
gattggctaaacccttcaacctctccactggatccttcaagccctctattgttcatcacg
ggacctcttacgggggcaaatggacccgctacaggacggtttactgtgtgcggacgttct
ccccaaacaggcttatggggggaggcaaatattgggggctttgtcggtcctgaactgcga
tacgccggatttgatgcagtcctggttacgggaaaagcgccaactccggtctatttatgg
attcatcaaggagatgcccagatcagggatgcttcgcacctctggggaaaaaccgatatc
tacgaaacccaggtgcaaattcgccaggaattagaagaaccacgcgccaggattgcctgt
atcggtttggcggcagaaaatggcgttgtgttttctggaattttttccgatcacggtcgc
gcagcagcacgtaccggcttgggattgctcatggcatcaaagaatctcaaggcgttagcc
gtccgcggtacccaaaaaattccacttgctttgcccgagcgtttttctgaagagaggata
cgggttaataaagaactggcaaaccataacatgacggcagttttccgagccactggcact
tcgggtgcggcagaatatctgcagatgcttggggatatgcctcaaaaatactggatgggt
gcaagtttcgacggggcagacaaaatcagcggggcacaaatggctgaaaccattctggcg
ggtaccgcagcctgtcagggatgtgtaatttcctgtggaagggttgtctcgatcccggaa
ggaccttatcagacaaatgggaagacaaaaggtcccgagtatgaaaccatttgttcattc
ggctcacaattgctggttgatgacctggcggcaatcactgcattgggagaaacatgcgac
cgtttggggatggactcgatttccgctggaagtgtgattggcttagcctacttattattt
gagcggggtattctcaccgagaaagacacagaaggactgacgcttcagtggggagatcct
aaacccgcatttgtgttccttgaaaaaatggctcgtcgtcaaggcattggggaatggatg
gcacagggaagccgtgcctttgccgctcgattgggtgtagaagaactggctgtccaggtc
aatgggttggatgttgccatgcatgatcctcgagcattcagtggacaaaccctttcttat
ctcacttctccccgaggggcgtgtcataatcagagtgatttcttcaccgtggaactcggc
ggtactctggatgaaatcggtatccccatgacagatcgttttaccgatgccggtaaggca
aaatatgttgcaaggcatcagcactggcgttcggtttgtaatagcctggtgatgtgcttt
tttgcttcggtttctccaaaggatgtggttgatttactgaacttggcaactggtgaggaa
tggacattggactctctcatgactgcgggggaaagaatctggaatttgaagcggttatac
aatcttgctctggggtattctccagacaacgagaaacttcctgctcttctgttgcaggct
ttaccagatgggggacagggcggttttatccccgatgtccagacgcttaaaaaagaatat
tacgaagcgtgtgggtgggatcaaaaaagcggtatgccgggaaaagaggtgatcgacagg
ctaaatttgggatttacgaaggataaattttga

DBGET integrated database retrieval system