KEGG   Anaerolinea thermophila: ANT_14840Help
Entry
ANT_14840         CDS       T01410                                 

Definition
(RefSeq) putative glyceraldehyde-3-phosphate: ferredoxin oxidoreductase
  KO
K11389  
glyceraldehyde-3-phosphate dehydrogenase (ferredoxin) [EC:1.2.7.6]
Organism
atm  Anaerolinea thermophila
Pathway
Glycolysis / Gluconeogenesis
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:atm00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    ANT_14840
   01230 Biosynthesis of amino acids
    ANT_14840
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    ANT_14840
Enzymes [BR:atm01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.6  glyceraldehyde-3-phosphate dehydrogenase (ferredoxin)
     ANT_14840
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NITE: 
UniProt: 
Position
complement(1653973..1656006)
Genome map
AA seq 677 aa AA seqDB search
MTYPLMLRELVIHLDTGEYEINRIEDPRIIGPVDYGWSKYHSHLHMTGQRDPALFTFGGG
PLAGSRIPGTRRLVFCSYSPLWDGFYISSMGGAAYILHRVGVDFVCLKGEAKQDSVLILN
HKDGQVTARLESINPDVLWNGYVNPQGEWLTGFYALQQAVFDRYKDEYEGDWVRVFAVGP
GARYTNQGIIGSNPVRRGILTPIEDWAGRGGLGSRLLQCHRIAACIFGGDWVDPDLQDSK
EIDAYFMTYYQQSMIKTDLGATEKYRYVPDFQTGGTFGVNMLTVEEKLLSFNYRSIYQAP
EERLKQHKEFILNHYLKQFNEEIIQPKQFDHCGEPCSVVCKKYTGKYKKDYEPYQALGPL
CGVFDQRAAEELNHFVDSLGLDAIQIGSTVSWIMECVAEGLIRPEDFNLPSASELSFHFA
NDPIKFQIVEDSLKNARYAREIINMLMDKDKGKVFQSGIRAAAYALDERYGYTQPGKRTI
DRAVFTSHGRLGCMTINQYWVPGMLSPMPMMGKYFVYYGVEYLSPRELGRKCVHRMVYEF
FSENSGVCRFHRKWVEAIVDEIITAHYDLGIDYTKHQFNLCKDIHDHESPSVVFWESERN
IDLIWKFLEDWKLRGLNDASLEDWLNRFQQDKYRAARQFWDEIREGIEEAFEAGADSIPE
IAPPYKAAKLDIMEQKN
NT seq 2034 nt NT seq  +upstreamnt  +downstreamnt
atgacttatcccttgatgttaagagagttggtcatccacctggacactggcgagtacgaa
atcaatcggattgaggaccctcgcatcatcgggccagtggattatggatggtccaagtac
cactctcacttgcatatgaccggacaaagagatccagcgcttttcacttttggaggaggg
cctctggctggttcacgaatccctggcacgcgccggctggtcttttgctcatattcgcct
ctatgggatggcttctacatcagcagtatgggaggcgccgcatatatcctgcaccgggtg
ggtgtggattttgtctgtctgaaaggggaagccaaacaagactctgttctgattctcaat
cataaagatggacaggtaaccgcgcgtttggaatctatcaacccggatgtgctctggaac
gggtatgtcaaccctcaaggagaatggctgacaggattttatgctctgcaacaagccgta
tttgatcgatacaaagatgaatacgagggagattgggtacgggtttttgccgtaggtcct
ggagcgcgatataccaatcagggaatcattgggagtaatccggtacgtcgcggtatcctt
acgcccatcgaagactgggcaggccggggtggtttgggcagtcgcttgctccagtgccat
cggattgccgcctgcatttttggcggtgactgggtggatccggacctgcaagactccaaa
gaaattgatgcgtacttcatgacgtattaccagcaatccatgattaaaacagatctgggt
gcgacagagaagtaccgctacgtccccgactttcagactggcggcacctttggggtcaat
atgctcacggtggaggaaaaactgctcagttttaattatcgttccatctatcaagccccg
gaagagcgattgaaacagcataaagagttcattcttaaccattacctcaagcaattcaat
gaggaaattattcagcccaagcaatttgatcactgtggcgagccttgctcagtggtttgt
aagaaatatacaggaaaatacaaaaaagactacgaaccttatcaggctttgggtccccta
tgcggagtattcgatcaacgagcagcggaggaattaaatcattttgtcgattcccttggg
ttggatgcgattcaaattggcagcacggtctcgtggatcatggagtgtgttgcagagggg
ctgattcgaccagaagactttaatttaccctctgcgagtgaattgagttttcattttgcc
aatgaccccataaaattccaaattgtagaagattccctgaaaaacgcccgttatgcccgg
gaaatcattaacatgctcatggataaagacaaagggaaagtttttcaatcgggaattcga
gccgctgcctacgcgctggatgagagatatggatacacccaacccggaaaacgaaccatt
gaccgggctgtcttcacttctcatggtcgactggggtgtatgactatcaatcaatactgg
gtaccaggaatgctcagcccgatgccaatgatgggcaaatacttcgtctattacggtgta
gagtatctctcaccccgggaattggggagaaagtgtgtacaccgcatggtatacgaattt
ttctcagaaaacagcggggtgtgccgattccatcgcaagtgggttgaagccatcgtagat
gagattattacagctcattatgatttaggtattgactacacgaaacatcagtttaatctg
tgtaaagatatccatgatcatgaaagtccatcggtggtgttctgggaaagtgaacgcaac
atcgatcttatctggaaattccttgaagactggaaattacgcggattgaacgacgccagc
cttgaggattggctgaatcgattccaacaggacaaataccgtgcagcccggcaattctgg
gatgaaattcgtgaaggaatagaagaagcatttgaagccggtgcagattccattccagag
attgcgcctccctacaaggcagccaaactggatatcatggagcaaaagaattag

DBGET integrated database retrieval system