KEGG   Anaerolinea thermophila: ANT_17220Help
Entry
ANT_17220         CDS       T01410                                 

Definition
putative aldehyde ferredoxin oxidoreductase (EC:1.2.7.5)
Orthology
K03738  
aldehyde:ferredoxin oxidoreductase [EC:1.2.7.5]
Organism
atm  Anaerolinea thermophila
Pathway
Pentose phosphate pathway
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:atm00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    ANT_17220
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    ANT_17220
Enzymes [BR:atm01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.5  aldehyde ferredoxin oxidoreductase
     ANT_17220
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NITE: 
UniProt: 
Position
complement(1933090..1934853)
Genome map
AA seq 587 aa AA seqDB search
MWILRINMTDRSVKFEDVPEKYKYLAGRGLTSQIVYDEVPPLAHPLGPSNKLIFATGIVT
GTSAPTSARVSAGGKSPLTGGIKESNAGSPWAHDLAVMRIKALILEGLPEDKKTFWGIHL
SWDADAGKPKVDFFDATEYTGKDLYEVAPKLFERFGDRISFAGCGVSGEYGYGNAGIVYN
DLAKRPSRYSGRGGLGSVMGSKRVKFIVIDAKGAPGVEIVDKALFDEGRKKMIDAIRSHD
ITKPKGGLNSFGTAVLVNILNEAGGLPTRNFSSGRFEGAAKIAGEAIFETNKQRLGKDLY
NHACSPGCIIQCSNTLYDENGKEITSCVEYESDWALGANCGIDDLDAIGEMVQLCNAYGL
DTIETGCTIAVAMEAGVIPFGDAKGAIQLLHEMGKGTHLGRILGAGTETAGKVLGVTRIP
AVKGQSMPAYEPRAVKGIGVTYATTTMGADHTAGYTIAPEILSVGGKADPLSNEGKAALS
RAFQATTAFIDSSGHCLFIAFPILDIASGYQGMIDECNGVLGTKWTADDVLRIGSEILKV
ERAFNEAAGFTKAHDRMPEFMKREPLPPHNQVFDVPDEVLDAVYAEL
NT seq 1764 nt NT seq  +upstreamnt  +downstreamnt
atgtggattctcagaatcaatatgacggaccgcagtgtcaaatttgaagatgtgccggaa
aaatacaagtatctggcagggcgagggctgacttcccaaattgtttacgatgaagtgccc
ccgctggcgcatccactgggtcccagtaacaaactgatttttgccacaggtattgttacg
gggacatccgcaccaacctctgctcgtgtgtctgctggaggaaagtctccattgactggg
ggaattaaggagtctaatgcagggtctccttgggcgcatgatttggcggtgatgcgcatc
aaagccttaatcctggaagggcttccggaggataaaaagactttttggggtattcatctt
tcctgggacgctgatgcgggaaagcctaaggtggatttctttgatgccactgaatacacc
ggcaaagacctctatgaagtagccccaaaattgtttgaacgatttggcgaccgcatttcc
tttgccgggtgtggggtgtctggtgagtatggttatgggaatgcgggcatcgtctacaac
gatttggcaaaacgtccaagccgttactctggacgtggtggcttggggtcggtgatgggt
agtaagcgggtgaaattcattgtgattgatgccaaaggagcacccggagttgaaattgtt
gacaaagccctctttgacgaagggcgcaagaagatgattgatgcaattcgctcgcatgat
atcaccaaacccaaaggcggcttgaactcgttcggaacggcggtgctcgtcaatattttg
aacgaggctggcgggttgcccacacgtaacttctccagtggacgtttcgaaggtgcggca
aagattgccggagaagccattttcgagaccaacaaacagcgccttggcaaggatctctat
aaccacgcttgcagccccggatgtatcatccagtgttccaataccctttacgacgaaaat
ggcaaagaaattacctcgtgcgttgagtacgagtccgactgggctctgggtgcaaactgt
ggcattgatgatctggatgcgattggcgaaatggttcaactgtgcaatgcctatggcttg
gacaccattgagaccggatgcacaattgcggtagccatggaagcgggagttattcccttt
ggcgatgcaaaaggtgctatccagttactccatgaaatgggcaaggggactcacctcggg
cgcattttaggcgcagggactgagaccgccggtaaggtactgggtgtaactcgcatccct
gcagtgaaagggcaaagcatgccggcttacgagcctcgtgcggtgaagggtattggggta
acttatgccaccactacgatgggtgcagaccatactgctgggtacaccattgcccccgaa
attttgagcgtgggtggaaaggctgatcccctttccaacgaaggaaaggctgctttgagc
cgtgctttccaggcgactacagcgttcatcgactcttccgggcattgtttgttcattgcc
ttccccattctggatattgccagcgggtatcagggcatgattgatgaatgcaatggcgta
ctggggacaaaatggacagcggatgatgtcctgcgcatcggaagtgagatcctcaaagtt
gagcgtgcattcaatgaggcggcaggattcaccaaagcccatgaccgcatgcccgagttc
atgaagcgtgaaccgttgccaccgcacaatcaggtgtttgatgtgcctgatgaagtgctg
gatgctgtttatgccgaactttag

DBGET integrated database retrieval system