KEGG   Anaerolinea thermophila: ANT_17630Help
Entry
ANT_17630         CDS       T01410                                 

Definition
NAD-dependent epimerase/dehydratase family protein
Orthology
K00091  
dihydroflavonol-4-reductase [EC:1.1.1.219]
Organism
atm  Anaerolinea thermophila
Brite
Enzymes [BR:atm01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.219  dihydrokaempferol 4-reductase
     ANT_17630
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NITE: 
UniProt: 
Position
1991905..1992909
Genome map
AA seq 334 aa AA seqDB search
MNLVTGATGHLGNVLVRELVSRSEPVRALVLPGEDLRSLEGLPIEIVEGNVLDLPSLISA
CQGVDTVFHLAGLVSILEEHEPILRKVNVEGTRNVIQAVLQTGVRRLVYTSSIHALTRPP
HGVLIQEDLPFDPQNPAGAYDRTKAEASILVLEAVQRDGLDAVIVCPTGVIGPYDYRRSE
VGEMILNWMTSRLDYIVKGGFDFVDVRDVARGHILARDYGIKGHTYILGGEQISVTQLRA
LVKEIRGLFAPALEFPKAIAFWFASLAEIYYKVTHTRPKFTRYSIETLLSNSQISIQRAK
TELGYAPRKLSETLRDTIAWWLEHFRKTRKSVRI
NT seq 1005 nt NT seq  +upstreamnt  +downstreamnt
atgaatctggttaccggcgcaacaggacatttgggaaacgtactggtcagggaattggtt
tcccgtagtgaacccgtgagagccctggtcttacccggtgaagaccttcgttctctggaa
ggtttaccgattgaaattgttgaagggaatgttctggatctcccctcactgatttcagcc
tgtcagggcgtggacacagtgtttcatctggcaggacttgtttctatactggaagaacat
gaaccgattctgcggaaagtgaacgttgaaggcacccgcaacgtgattcaagccgttctt
cagaccggggtacgacgtttggtatacaccagttctatccatgcacttacccgtccgcct
catggagtcctcattcaagaagacttgccttttgatccacaaaatccggctggcgcctac
gatcgtacaaaagcagaagcctctattctggtactggaagccgtccaaagggacggattg
gatgctgtgattgtctgccccacaggagtgattggaccttacgactaccgtcgttcagag
gtaggagagatgattttaaactggatgacctccagactggattatattgtgaagggtggc
tttgactttgtggacgtacgcgatgtagcaagaggacatatcctggctcgtgattatggt
atcaaagggcatacgtacattctcgggggagaacagatttctgttacacaactgcgagcg
ttggttaaggaaatacgcggattgtttgctccagcactcgaatttccgaaagccatagcg
ttttggttcgcctctctggcagaaatttactacaaagtcacgcatacccgcccgaagttc
acccgttactccatagaaacgttgttgagtaactctcaaatcagtatccagcgggcaaaa
actgagttgggttatgcgccaagaaaactatcggagaccttgcgagacactatcgcatgg
tggctggaacatttccgaaaaacgcgtaaatcggttcgaatataa

DBGET integrated database retrieval system