KEGG   Anaerolinea thermophila: ANT_18060Help
Entry
ANT_18060         CDS       T01410                                 

Gene name
tal_pgi
Definition
transaldolase/glucose-6-phosphate isomerase (EC:2.2.1.2 5.3.1.9)
Orthology
K13810  
transaldolase / glucose-6-phosphate isomerase [EC:2.2.1.2 5.3.1.9]
Organism
atm  Anaerolinea thermophila
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Pentose phosphate pathway, non-oxidative phase, fructose 6P => ribose 5P
Class
Metabolism; Overview; Carbon metabolism [PATH:atm01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:atm01230]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:atm00010]
Metabolism; Carbohydrate metabolism; Pentose phosphate pathway [PATH:atm00030]
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:atm00500]
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:atm00520]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NITE: 
UniProt: 
Position
complement(2032830..2035607)
Genome map
AA seq 925 aa AA seqDB search
MSNRFQQLMQVGQSLWYDNIQRSLIKNGTLKRMIEEGEIRGITSNPTIFNLAISKSQDYD
SAIAPMAWAGWSAEQIFYQLAVEDIQSAADLFLPLYEKSDRADGYVSLEVSPYLARDAQA
TVREALELWKRVDRPNLMIKIPATREGLEAIREAIAQGINVNVTLIFSLERYREVIEAYL
SGLEKRVNAGLPVDRIASVASFFVSRVDTKVDALLEKLIAEGNLTEEEACSLMGKTAIAN
AKLAYQIFKETFNSSRFKRLAEKGARVQRPLWASTSTKNPRYRDVLYVEELIGPLTVNTV
PPQTLDAFRDHGNVSLTLEEGVEEAKSHLAHLEHLGISMSLVTAQLEEEGVKAFADSFST
LLQTLTQRKEEFNSSLGPLARAVSQRVKVFEETQFIERFHRHDPFLWSSIPEEQEEIRKR
MGWLEAPQTSRALVSAIEQFAQEVVEAGFTHAVLLGMGGSSLAPEVLRQVFGVGKIGEHP
ALDLLILDSTDPAQVLAVESWSPVERTLYIVSSKSGTTIEITAFMEYFWKKAVDRFGSKA
GSHFIAITDPGTKLEKIAKERNFRKVFLADPTVGGRNSALTAFGLVPAGLLGINLEEFLS
RAEQISRECRPQIPAGRNPGLVLGAILGESALAGRDKVTLLTDALWQPLGAWLEQLIAES
SGKRGKGIVPVDLEPLYPADVYGADRLFVYLRSTGEKDDFVNQLVQGDHPVVVITTNDPM
DLAGEFYRWEVATAVACSVIGVNSFDQPDVQDNKDRSVKKIQNFHETGVLEQEKPVWEKH
GVQVFSTSPIDGLSLKEVVMRFLQNATQGDYIAINAYLPRTPEMQTVLGKLRTWIQQLTG
LPTTLGFGPRFLHSTGQLHKGGANNGLFLQITADSQTDVEIPGMNLTFGQLERAQALGDY
ESLVARGRRVIRIHLGKTPHEILDF
NT seq 2778 nt NT seq  +upstreamnt  +downstreamnt
atgagcaaccgattccagcaattaatgcaggtaggtcaatccctttggtatgacaatatt
cagcgttccctgattaagaacggaacgctgaagcgaatgattgaagaaggtgaaattcgc
gggattacctcgaaccccacaattttcaatctggcaatctccaaatcacaggattatgac
tcggccattgcaccaatggcttgggcaggttggagtgcagagcagattttttatcaactg
gcagtggaagatattcaatctgccgctgaccttttcctccccctgtatgaaaaaagtgat
cgggcggatggatacgtaagtctggaagtgagtccataccttgccagagatgcacaagca
acggtgcgagaagcccttgaactctggaagcgtgttgaccgcccgaatttgatgattaag
atcccggctactcgagagggacttgaagccattcgggaagcgattgcacagggtatcaat
gttaatgtgaccttgatcttttccctggaacgttaccgtgaggtcattgaggcttacctt
tctggtttggaaaagcgagtgaatgcaggtttaccggtagatcgcattgcctctgtggct
tctttcttcgtttcccgggtggatacaaaggttgacgctcttttagagaagttaattgca
gaaggaaatttgactgaggaagaagcctgctccctgatggggaaaacggctattgctaat
gctaaactggcgtaccagatctttaaggagacctttaactcctcccggtttaagagattg
gcagaaaaaggggctcgggtacagcgcccgctctgggcttctaccagcacgaagaatcca
agataccgtgacgtgctttacgttgaagaactgattggccctttgacggttaatacggtt
cctcctcaaactctggacgcattccgtgatcacggtaacgtatcattaacccttgaagag
ggtgtggaagaggcaaaatctcatctggcacacctggagcacctgggaatttccatgtcg
ttggtcactgcccaattagaagaggaaggggttaaagccttcgccgattctttctctacg
ttgttacagacgctaactcaacgcaaggaagagtttaactccagtttaggtccacttgcc
cgggcagtatctcaaagggttaaggttttcgaagagacacaatttatagaacgttttcac
cgccatgatccatttctctggtcatcgattccagaggaacaagaagaaattcgcaagcga
atgggatggttggaagcccctcaaaccagtcgggctcttgtttctgcaattgagcaattt
gcccaagaagtagtagaggcgggtttcacccatgccgtcttgctgggtatgggggggtct
tcgttagccccggaggtcttacgtcaggtgtttggagtgggcaagattggagagcatccg
gctctggacttgttgattctggactctaccgaccctgcgcaggttctggcagtcgagtca
tggtccccggttgagcgaacgctttacattgtttccagtaagtctggaacgaccattgaa
atcacagcattcatggagtatttctggaaaaaagccgtggaccgttttggctccaaagcc
ggttctcattttattgcaattaccgaccccggtacaaaactggaaaagattgcgaaggaa
cgaaatttccgcaaagtgtttttagccgaccccactgttggaggacggaattcagcgctg
acggctttcggattggtgccggctggtttgttgggaattaatttggaggagttcttgtcg
cgcgccgagcaaatttccagagaatgccgtcctcagattcctgcgggacgcaatcccggc
ttggtgctgggagccattctgggagaatccgcactggcagggcgtgataaggtgactttg
ctcacagatgctctctggcaacctctgggggcgtggctggaacaattaatcgctgaaagc
agtggcaagcgtggcaagggcattgtcccggttgacctggaaccactttatccagcagat
gtgtatggtgcggatcgcctgtttgtatacttgcgttctacaggagagaaagatgatttt
gtgaaccaattggttcaaggtgatcatccggtggtggtgataaccacaaacgatcccatg
gatcttgcgggagagttttaccgctgggaagttgctacggctgttgcatgttcggtcatt
ggcgtaaatagttttgatcagcccgatgtacaggacaataaagatcgcagtgtgaagaaa
attcaaaacttccacgaaacgggagtactggaacaggaaaaacctgtatgggagaagcat
ggtgttcaggttttcagtacatctccaattgatgggctgtctcttaaggaagtggtgatg
cgttttcttcaaaatgctactcagggggactatattgccatcaatgcttatttgccccgc
actcccgaaatgcagacggttttaggaaaattgcgtacctggattcagcaattgaccggc
ttgccgacgactctgggctttgggccccgtttcttacattcaaccgggcaattgcacaaa
ggtggggcaaacaatgggttatttctccagattaccgctgactctcaaaccgatgtagaa
attccgggcatgaacttaacttttgggcaattagagcgagcccaagcgttgggagattac
gagtcacttgttgcgcgtggacggcgggtgatccgaattcatctggggaaaacacctcac
gagattctggatttctag

DBGET integrated database retrieval system