KEGG   Anaerolinea thermophila: ANT_18750Help
Entry
ANT_18750         CDS       T01410                                 

Definition
endoglucanase (EC:3.2.1.-)
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
atm  Anaerolinea thermophila
Pathway
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:atm00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NITE: 
UniProt: 
Position
complement(2109473..2110651)
Genome map
AA seq 392 aa AA seqDB search
MKMNKTQIPSFFSPLWMVLIILTLFGCAVRPDADISVTTDKAGTRLSGSLSSTKTVPPFP
SVPGNTSTPVPSVISGADEHVFEQNRRLGRGINLGNALEAPSEGEWGVTLNETFFLLISS
AGFDSVRIPIRWSAHADSEFPYTIDPVFFKRVDWAIEQAFRNNLRVVINIHHYDELMENP
RLHHDRFLAIWEQIALHYQDYPESLYFELLNEPHGPLSVFWSDLAAEAIRTIRKTNPERT
LIVGPGNWNNMGALQDLTLPETDRNLIVTVHYYSPFEFTHQGAEWVSGSEKYLGTPWEGK
EWEKKAIDTDFDLALMWAQKYHRPIFLGEFGAYSKADMDSRKRWTEYVARSAEKRGFSWA
YWEFCAGFGVYNAQTHVWVEPLLTALIPSALP
NT seq 1179 nt NT seq  +upstreamnt  +downstreamnt
gtgaaaatgaataagacgcaaatcccctccttttttagccctctttggatggttctgata
attttgacgctgtttggttgtgccgttcgtcctgatgccgatatctctgttacaactgat
aaggcaggaacacgcttgtcagggagcctatcatctacaaaaactgtgcctccatttcct
tctgtacctggcaatacttctacgccggttccctctgtgatctctggtgcagatgagcat
gtctttgagcaaaatcgtcgtttgggtagagggattaacctgggaaatgctttggaagcc
ccaagtgaaggcgagtggggtgtaaccctgaacgaaacatttttcttgttgatttcttca
gcagggtttgacagtgtgcgtattcctatccgatggagtgcccatgccgattctgagttc
ccatataccatcgatcctgtattttttaagcgggtggattgggcgattgaacaggcgttc
aggaataacttgcgtgtagtcatcaatattcaccattacgatgagttgatggaaaaccct
cggctccatcacgatcgctttcttgcgatttgggagcaaattgctttgcattatcaggac
taccctgaaagtttgtattttgaattgctgaatgaacctcatggccctctgtcggttttc
tggagtgatctggctgctgaagccattcgaactattcgtaaaaccaacccggagcgcact
ctcattgtaggccctggaaactggaacaacatgggagcattgcaggatttaactcttccc
gaaacagatcgaaacctgattgtgactgtgcactattattcaccttttgaatttactcat
cagggggctgaatgggtttcggggagtgaaaagtatctgggtactccatgggaaggaaag
gaatgggaaaagaaagccattgataccgacttcgatttggctttaatgtgggctcaaaag
tatcatcgtcctatttttctgggggaatttggtgcctattccaaagccgatatggactcc
cggaaaagatggacggagtatgtggcgcgttcggcagaaaagcgtggtttttcctgggcg
tactgggaattctgcgcaggctttggagtctataatgctcaaacccacgtatgggtggaa
ccacttctcacggcgttgattccctctgctctcccgtga

DBGET integrated database retrieval system