KEGG   Anaerolinea thermophila: ANT_18810Help
Entry
ANT_18810         CDS       T01410                                 

Gene name
adh
Definition
alcohol dehydrogenase (EC:1.1.1.1)
Orthology
K13953  
alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
atm  Anaerolinea thermophila
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:atm00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    ANT_18810 (adh)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    ANT_18810 (adh)
  Lipid metabolism
   00071 Fatty acid degradation
    ANT_18810 (adh)
  Amino acid metabolism
   00350 Tyrosine metabolism
    ANT_18810 (adh)
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    ANT_18810 (adh)
   00626 Naphthalene degradation
    ANT_18810 (adh)
Enzymes [BR:atm01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     ANT_18810 (adh)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NITE: 
UniProt: 
Position
2116991..2118019
Genome map
AA seq 342 aa AA seqDB search
MRAMQITRITSVLDDPEPLQFTTNKPIPACQKDEVLIRVSACGVCHTEIDEIEGRTPPSH
FPMTPGHQVVGQVVEVGDARNAHLLGKRVGVAWIYSSCGSCEFCLSGRENLCPEFRATGR
DANGGYAEYMNVLADYVHPIPDHLDDVSAAPLLCAGAVGYRSLWLSGIANHQNLGLVGFG
ASGHLVLKLVRFLYPHTQVFVFSRTPAEQDFARELGATWAGGIEDAPTERLHAAIDTTPV
WTPPVQTLRHLLPGGRLVMNAIRKENSDLSIWSSVQYERDLWMEKEIKSVANVTRNDVRE
FLKLASQIPILPEVEIYSLEEANMALKALKQRKIRGAKVLKI
NT seq 1029 nt NT seq  +upstreamnt  +downstreamnt
atgcgcgccatgcaaattacccgtatcacgtcggttctggatgatccagaacctctgcaa
ttcaccaccaataaacccattccagcatgtcaaaaggacgaagtgttgattcgggtttcg
gcttgcggagtttgtcacacagaaatcgatgaaattgaaggcagaacaccccccagccat
tttcccatgactcccggtcatcaagtcgtagggcaggttgtagaagttggagacgcaaga
aatgctcatctcctcggaaagcgagtcggagtggcttggatttattcttcctgtggatcc
tgcgaattttgcttgagcgggagggaaaatctttgcccggaattccgcgccaccggaaga
gacgcaaatgggggctatgccgaatacatgaacgtactggcagactatgttcatccaatc
ccggatcatcttgatgatgtctcggcggctcccttattatgtgccggcgccgtgggctat
cgctctctctggctgagcggaatcgccaatcaccagaatctgggattggtggggtttggt
gcatccggtcaccttgtactcaaactggttcgatttctctacccccatacacaagttttt
gtattcagccgaacgccggctgagcaagactttgcccgggaattaggcgcaacctgggca
ggtggaatagaagatgctcctaccgaacgacttcatgctgccatcgacaccacgcctgtg
tggacacctccagttcaaactctcaggcatcttctacctggcggcagactggtaatgaat
gcaatccgaaaagagaattctgacctctctatctggtcctctgttcaatacgagcgcgat
ctctggatggagaaagagataaagagcgttgccaacgtcacccgtaatgatgtacgggaa
ttccttaaacttgccagccaaattcccattcttcccgaagtggaaatctattctctggaa
gaagccaacatggcattgaaagcacttaaacaacgtaaaattcgaggagcaaaggttttg
aaaatttaa

DBGET integrated database retrieval system