KEGG   Anaerolinea thermophila: ANT_19060Help
Entry
ANT_19060         CDS       T01410                                 

Gene name
pcm
Definition
protein-L-isoaspartate O-methyltransferase (EC:2.1.1.77)
Orthology
K00573  
protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
atm  Anaerolinea thermophila
Brite
Enzymes [BR:atm01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     ANT_19060 (pcm)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NITE: 
UniProt: 
Position
2140633..2141304
Genome map
AA seq 223 aa AA seqDB search
MDTESSWFEARLRMVKEQIEQRGIRDPRVLQAMREVPRHLFVPEEEQPYAYEDCPLPIGF
GQTISQPYMVAIMTALLELRGDEKVLEVGTGSGYQAAILSRIAREVHTIERHQALAQKAG
ERLQALGYTNVKVHVGDGSLGIPEEAPFQGIIVTAAAPKVPTPLLEQLSMNAYLVIPVGG
PGGQELMRWQKTPAGFEPKELFPVAFVPLRGKEGWKEDQWYSR
NT seq 672 nt NT seq  +upstreamnt  +downstreamnt
atggacacggaaagttcatggtttgaagcgcgtttacgcatggtgaaagaacaaatcgaa
caacggggtattcgcgacccacgtgtcctacaagccatgcgagaagtgccacggcatctt
tttgttccagaagaagagcaaccctatgcatatgaagactgccctctacctatcgggttt
gggcagaccatttctcaaccctacatggtagcgattatgacagcactcctggaattaaga
ggggacgagaaagttctggaagtaggcaccggctctggataccaagccgccattctcagc
cggatagcacgcgaggtgcataccatcgaacgccatcaggcgcttgcccaaaaagcagga
gaacgcttgcaggcgttaggctatacaaatgtcaaagtgcatgtaggggatggctcactg
ggaatacctgaagaagcgccttttcaaggaattattgtgacagcagcagcaccgaaagtt
cccacacctttgctggaacaactatcaatgaacgcttatcttgtcattcccgttggcggg
cctggcgggcaggaattaatgcgctggcagaagacacctgcagggtttgaaccgaaggaa
cttttcccagtagcattcgtgcctttgcgaggcaaagaaggctggaaagaagatcaatgg
tactcccgataa

DBGET integrated database retrieval system