KEGG   Anaerolinea thermophila: ANT_19280Help
Entry
ANT_19280         CDS       T01410                                 

Gene name
tpiA
Definition
(RefSeq) triosephosphate isomerase (EC:5.3.1.1)
  KO
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
atm  Anaerolinea thermophila
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:atm00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    ANT_19280 (tpiA)
   01230 Biosynthesis of amino acids
    ANT_19280 (tpiA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    ANT_19280 (tpiA)
   00051 Fructose and mannose metabolism
    ANT_19280 (tpiA)
   00562 Inositol phosphate metabolism
    ANT_19280 (tpiA)
Enzymes [BR:atm01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     ANT_19280 (tpiA)
Exosome [BR:atm04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   ANT_19280 (tpiA)
  Exosomal proteins of bladder cancer cells
   ANT_19280 (tpiA)
  Exosomal proteins of melanoma cells
   ANT_19280 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
NITE: 
UniProt: 
Position
2162068..2162835
Genome map
AA seq 255 aa AA seqDB search
MRKKFVAGNWKMNKTAEEARLLLNELIPALEPFSHVERAVCPPFPYLMMVRHMLEGTNIG
MGAQNMHWEASGAFTGEVSPKMVAEFCQYVILGHSERRTYFGETDETVNRKVKSALSTGL
TPIVCVGETLAENEAGKTAEVVWRQITEGLKDLLPEEGLKLVIAYEPVWAIGTGRAATAE
VAQSVHANVVRPALAHLFGQEVAGQIRIQYGGSVTAKNAPELFAMPDIDGALVGGASLKA
GEFAAIVQAAAEAKA
NT seq 768 nt NT seq  +upstreamnt  +downstreamnt
atgcgcaagaaattcgtagccggtaactggaaaatgaataaaacagccgaagaagcgcgt
cttctgctaaacgaattgatccctgctctggaacctttttctcatgtagagcgcgctgtt
tgccctcccttcccgtacctgatgatggtccgccacatgttagagggaacaaatatcggg
atgggagcacagaacatgcactgggaagcctccggtgccttcactggagaagtctctccc
aaaatggttgccgagttctgccaatatgtcattctgggacactccgaacgccgtacgtat
tttggcgaaactgatgagactgtgaatcggaaggtcaagtcggcactttccaccggatta
acgcccattgtatgtgtgggagaaactcttgcagaaaatgaggcaggaaaaactgccgag
gtggtttggcgtcaaattaccgaagggttgaaagatctcttgccggaagaagggctgaaa
ctggtcattgcctacgaaccggtttgggcaattgggacagggcgagccgcaacagcagaa
gttgctcagtcagtacacgcgaacgtcgttcgtccggctttggctcatctgttcgggcaa
gaagtagccgggcagattcgcattcaatacggcgggtcggtgaccgccaagaacgctccc
gagttattcgccatgcccgatattgatggcgctctggtaggcggtgccagtctgaaagcc
ggcgaatttgcggcaattgttcaggctgcagcagaagccaaggcataa

DBGET integrated database retrieval system