KEGG   Anaerolinea thermophila: ANT_19280Help
Entry
ANT_19280         CDS       T01410                                 

Gene name
tpiA
Definition
(GenBank) triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
atm  Anaerolinea thermophila
Pathway
atm00010  Glycolysis / Gluconeogenesis
atm00051  Fructose and mannose metabolism
atm00562  Inositol phosphate metabolism
atm01100  Metabolic pathways
atm01110  Biosynthesis of secondary metabolites
atm01120  Microbial metabolism in diverse environments
atm01130  Biosynthesis of antibiotics
atm01200  Carbon metabolism
atm01230  Biosynthesis of amino acids
Module
atm_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
atm_M00002  Glycolysis, core module involving three-carbon compounds
atm_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:atm00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    ANT_19280 (tpiA)
   00051 Fructose and mannose metabolism
    ANT_19280 (tpiA)
   00562 Inositol phosphate metabolism
    ANT_19280 (tpiA)
Enzymes [BR:atm01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     ANT_19280 (tpiA)
Exosome [BR:atm04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   ANT_19280 (tpiA)
  Exosomal proteins of bladder cancer cells
   ANT_19280 (tpiA)
  Exosomal proteins of melanoma cells
   ANT_19280 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM AP_endonuc_2
Motif
Other DBs
NCBI-ProteinID: BAJ63954
NITE: ANT_19280
UniProt: E8N690
Position
2162068..2162835
Genome map
AA seq 255 aa AA seqDB search
MRKKFVAGNWKMNKTAEEARLLLNELIPALEPFSHVERAVCPPFPYLMMVRHMLEGTNIG
MGAQNMHWEASGAFTGEVSPKMVAEFCQYVILGHSERRTYFGETDETVNRKVKSALSTGL
TPIVCVGETLAENEAGKTAEVVWRQITEGLKDLLPEEGLKLVIAYEPVWAIGTGRAATAE
VAQSVHANVVRPALAHLFGQEVAGQIRIQYGGSVTAKNAPELFAMPDIDGALVGGASLKA
GEFAAIVQAAAEAKA
NT seq 768 nt NT seq  +upstreamnt  +downstreamnt
atgcgcaagaaattcgtagccggtaactggaaaatgaataaaacagccgaagaagcgcgt
cttctgctaaacgaattgatccctgctctggaacctttttctcatgtagagcgcgctgtt
tgccctcccttcccgtacctgatgatggtccgccacatgttagagggaacaaatatcggg
atgggagcacagaacatgcactgggaagcctccggtgccttcactggagaagtctctccc
aaaatggttgccgagttctgccaatatgtcattctgggacactccgaacgccgtacgtat
tttggcgaaactgatgagactgtgaatcggaaggtcaagtcggcactttccaccggatta
acgcccattgtatgtgtgggagaaactcttgcagaaaatgaggcaggaaaaactgccgag
gtggtttggcgtcaaattaccgaagggttgaaagatctcttgccggaagaagggctgaaa
ctggtcattgcctacgaaccggtttgggcaattgggacagggcgagccgcaacagcagaa
gttgctcagtcagtacacgcgaacgtcgttcgtccggctttggctcatctgttcgggcaa
gaagtagccgggcagattcgcattcaatacggcgggtcggtgaccgccaagaacgctccc
gagttattcgccatgcccgatattgatggcgctctggtaggcggtgccagtctgaaagcc
ggcgaatttgcggcaattgttcaggctgcagcagaagccaaggcataa

DBGET integrated database retrieval system