KEGG   Anaerolinea thermophila: ANT_20040Help
Entry
ANT_20040         CDS       T01410                                 

Gene name
asnB
Definition
asparagine synthase (EC:6.3.5.4)
Orthology
K01953  
asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
atm  Anaerolinea thermophila
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:atm00250]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NITE: 
UniProt: 
Position
2244990..2246972
Genome map
AA seq 660 aa AA seqDB search
MCGIAGIISKERQTSVQQEDLLGMVSMLRHRGPDEFGLYLNGPVGLGSARLSIIDLSGGQ
QPISNEDQTLWIVYNGEIFNYPELRARLQALGHTFTTRTDTEVILHLYEEYGVDCLKHLN
GQFALAIWDENKQRLFLARDRLGIRPLYYTQAPLGFLFGSEIKSILAYPGIRAEINREAL
IQTFVFWSVQSPLSTFSNIFQIPPGHFLTYQNEKIELHPYWQLDFSNGLEPSFSLRAGLE
ELKRLLLDATLIRLRADVPVGAYLSGGLDSSLTTALIQKYSQSRLETFSIAFSDAEYDES
AFQQKMADTLGTRHHMVHTTYEDIGRTFPEVIWHTETPILRTAPVPMYLLSNLVHQHGFK
VVMTGEGADELFGGYDIFKEMLIRRFWARDPESKLRPRLLDTLYPEIAGLSDSARNFFTA
FFKMDLLSTSSPFYSHMIRWKNGIRLLRFLQPQPNTSWEELAQSLPIPEHFRSWNALSQA
QYLEIITFLSSYLLSSQGDRVAMAHSVEGRFPFLDYRVVEFASKLPSNWKLYGLTEKWIL
RQIARELLPEEIWKRRKKPYRAPIHKSFFHSHPPEYIAEVISPDYLEETSLFNPLAVHQL
FQKALHGAFLSELEDMAIAGILSTQLVYRQFVQNFPCPKSDSTLSIPLKIVRRNSEGTHL
NT seq 1983 nt NT seq  +upstreamnt  +downstreamnt
atgtgtggtattgccgggatcatatcaaaagaacgccaaacctccgtccagcaggaagac
ctgctagggatggtctccatgcttcgacatcgaggaccggacgagtttggcttgtatctg
aacggtccggtaggcctggggagcgctcgtttgagcattattgacctgagtggaggacaa
caaccaatctcaaacgaagaccagactctgtggattgtgtacaacggagagatcttcaat
tatcccgagttgcgggcgcgtttacaagccttaggacatactttcaccacacgtaccgat
acagaggtcatccttcatctctatgaggaatatggggtggattgtctgaaacaccttaat
gggcaatttgctctcgccatttgggatgaaaacaaacaacggctgtttttagcaagagat
cgattgggtattcgacctttgtattacactcaagcacccctcggctttttgtttggttca
gaaatcaaaagtatcctggcatacccgggtatccgtgcagaaatcaatcgggaggctctc
atacaaacgtttgtgttctggagtgtacaatctcccctctcgactttttcgaatatcttc
caaattccaccaggtcatttcttaacttaccagaatgaaaaaatcgaattgcacccctac
tggcaactggatttttcgaacggtcttgagccatcattctctcttcgcgcaggattggaa
gagttaaaacgtctactcctcgatgcaactctgattcgcttgcgggcagacgtgcccgtt
ggagcgtatttgtctggtggactggactcttctctcaccaccgctctgattcagaaatat
tcccaaagccgtttggaaaccttctccatcgctttttctgatgcagagtacgatgaaagt
gcttttcaacaaaaaatggcagatactctgggaactcgtcatcacatggtacacaccacc
tatgaggatattggaaggacttttccggaggtcatctggcatacagaaactcctatcctg
cggactgcccccgtgcctatgtatctgctttccaaccttgtacatcaacacggtttcaag
gtggtgatgactggagaaggagccgatgaactgtttggcggatatgacatcttcaaagaa
atgctcattcgacgattctgggcacgagatccagaatccaagttgcgtcctcgtttactg
gacacgctctacccggaaattgctggcctttcggactcggcaaggaacttcttcactgca
ttctttaagatggatttgctttctacctcctcacctttttattcccatatgattcgctgg
aaaaatggcatcaggcttctgcgatttcttcaaccacaacccaacacttcatgggaagag
ttagcccagagcctgccaattcctgagcatttcaggtcctggaatgcactttcccaggca
caatatctggaaatcattaccttcctctcctcgtacttgctttcctcacagggagatcga
gttgccatggcacactctgtggaaggaagatttcctttcctggattatcgggtggtggaa
tttgccagtaagttaccttcaaattggaaactgtatgggctcactgagaaatggattttg
agacaaattgcccgagaactcctgcctgaagaaatctggaagcgaagaaaaaagccttac
cgcgctcccatccataaaagttttttccattctcatcctcccgagtacatcgcagaggtc
atctctcccgactacctggaagaaaccagtttgttcaatccattggcagtccatcagtta
ttccaaaaggctcttcatggtgcttttctcagtgaattggaagacatggctattgcagga
atcctgtccacccaactcgtatacagacaatttgttcagaattttccctgccccaaaagc
gacagcacgttatccatcccattaaaaattgtgcgaagaaactcagaagggactcactta
tga

DBGET integrated database retrieval system