KEGG   Anaerolinea thermophila: ANT_22160Help
Entry
ANT_22160         CDS       T01410                                 

Gene name
sdhD
Definition
putative succinate dehydrogenase membrane subunit (EC:1.3.99.1)
Orthology
K00242  
succinate dehydrogenase membrane anchor subunit
Organism
atm  Anaerolinea thermophila
Pathway
Citrate cycle (TCA cycle)
Oxidative phosphorylation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:atm00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    ANT_22160 (sdhD)
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    ANT_22160 (sdhD)
   00650 Butanoate metabolism
    ANT_22160 (sdhD)
  Energy metabolism
   00190 Oxidative phosphorylation
    ANT_22160 (sdhD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NITE: 
UniProt: 
Position
complement(2448167..2448550)
Genome map
AA seq 127 aa AA seqDB search
MTTTTRPVKVKRTFEQTAWLWMRYSAFLLIPLAWGHMILQDVVVGVHSITSEYAIQRIAN
LGWKIYDIFLLGFAFAHGMNGVRQVVRDYIRNPKTFQIVSIVLLVVWFVITLMGAIALLA
INQPIGG
NT seq 384 nt NT seq  +upstreamnt  +downstreamnt
atgacaacgacgactcgaccagtaaaagtcaaacgaacgtttgagcaaaccgcatggctg
tggatgcgttacagtgccttcctgctcatcccgttggcttgggggcatatgattctccag
gatgtggtcgtaggagtccacagcataacttcagagtatgccattcaacgtattgccaac
ctgggatggaagatttatgacattttcctgctagggtttgcctttgctcatggcatgaat
ggcgtaaggcaggtggttcgggactatattcgcaatccaaaaactttccagattgttagt
attgtcttgctggtggtctggtttgtcattaccttgatgggagccattgctttgctggcg
attaaccaacccattggaggatga

DBGET integrated database retrieval system