KEGG   Anaerolinea thermophila: ANT_22590Help
Entry
ANT_22590         CDS       T01410                                 

Definition
pyridoxal-phosphate dependent protein
Orthology
K05396  
D-cysteine desulfhydrase [EC:4.4.1.15]
Organism
atm  Anaerolinea thermophila
Pathway
Cysteine and methionine metabolism
Brite
KEGG Orthology (KO) [BR:atm00001]
 Metabolism
  Amino acid metabolism
   00270 Cysteine and methionine metabolism
    ANT_22590
Enzymes [BR:atm01000]
 4. Lyases
  4.4  Carbon-sulfur lyases
   4.4.1  Carbon-sulfur lyases (only sub-subclass identified to date)
    4.4.1.15  D-cysteine desulfhydrase
     ANT_22590
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NITE: 
UniProt: 
Position
complement(2494849..2495820)
Genome map
AA seq 323 aa AA seqDB search
MIPRLKLAALPTPIEFLPRLGAYLGGLRILIKRDDLTGVAFGGNKTRKLELVLAEAQSVG
AHTLITVGAVQSNHCRQVAALAARMGLKCKLVLYGEIPSRASGNLFLDRLFGAEIFWTSK
DARNETLNEVFGESWARGERPYLIPLGASNPLGAAAYALAFDEMLQQIQSERVDWIVVAS
SSGGTQAGLVLGAHRRHFHGRILGISIDEPERELKEVVAFLAREASDRLGKAMTIHPEDV
FVNADYLGGGYGVMGEAEREAITLFAQLEGVLLDPVYTGRAAAGLIDLARKGFFHRGETI
LFWHTGGTPALFADKYQNQLLSE
NT seq 972 nt NT seq  +upstreamnt  +downstreamnt
atgattccccgattgaaactggctgctttgcctacccccatcgagttcctgcctcgattg
ggtgcttatctgggtgggttgcgtattctgattaaacgagatgacctgaccggtgttgcc
tttggaggcaacaaaacccgcaaattggaactggtgctggcagaagcccaaagtgtaggg
gcacatacgttaattacggtgggggctgtacaatccaatcattgtcgccaggtagcggcg
cttgccgcgcggatgggattgaagtgtaaactggtcctttatggagagatcccgtcgcgg
gcttcaggtaacctgtttttagaccgcctgtttggtgcagaaattttctggacgagcaag
gacgcccgcaatgaaactttgaacgaggtgtttggcgagtcctgggcacggggagagcgc
ccatacctcatcccgttaggcgcatccaaccctttaggggctgcggcatatgcactggca
tttgatgaaatgctgcagcaaatccagtctgagcgcgttgattggattgttgtggcttct
tcgtctggaggtacgcaggcgggtctggtcttgggtgcgcatcgacgccactttcatgga
cgcattttgggcatcagcatcgatgaacccgagcgagagttgaaggaggtggttgcgttt
ctggcacgtgaagcctccgatcgtttgggaaaagccatgactattcatccagaggatgtg
tttgtcaatgccgattatttggggggtggttatggggtgatgggtgaggcggaacgagaa
gccattaccctgtttgcacaactggaaggggtgttgctcgatccggtctacacgggaagg
gcggcggctggattgattgatctggcacgcaaaggcttctttcaccgcggtgaaaccatt
ttgttctggcataccggaggaaccccggcactttttgccgataaatatcaaaatcaattg
ctcagcgaatga

  All links  
No link information was found.   
DBGET integrated database retrieval system