KEGG   Anaerolinea thermophila: ANT_22590Help
Entry
ANT_22590         CDS       T01410                                 

Definition
pyridoxal-phosphate dependent protein
Orthology
K05396  
D-cysteine desulfhydrase [EC:4.4.1.15]
Organism
atm  Anaerolinea thermophila
Pathway
Cysteine and methionine metabolism
Class
Metabolism; Amino acid metabolism; Cysteine and methionine metabolism [PATH:atm00270]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NITE: 
UniProt: 
Position
complement(2494849..2495820)
Genome map
AA seq 323 aa AA seqDB search
MIPRLKLAALPTPIEFLPRLGAYLGGLRILIKRDDLTGVAFGGNKTRKLELVLAEAQSVG
AHTLITVGAVQSNHCRQVAALAARMGLKCKLVLYGEIPSRASGNLFLDRLFGAEIFWTSK
DARNETLNEVFGESWARGERPYLIPLGASNPLGAAAYALAFDEMLQQIQSERVDWIVVAS
SSGGTQAGLVLGAHRRHFHGRILGISIDEPERELKEVVAFLAREASDRLGKAMTIHPEDV
FVNADYLGGGYGVMGEAEREAITLFAQLEGVLLDPVYTGRAAAGLIDLARKGFFHRGETI
LFWHTGGTPALFADKYQNQLLSE
NT seq 972 nt NT seq  +upstreamnt  +downstreamnt
atgattccccgattgaaactggctgctttgcctacccccatcgagttcctgcctcgattg
ggtgcttatctgggtgggttgcgtattctgattaaacgagatgacctgaccggtgttgcc
tttggaggcaacaaaacccgcaaattggaactggtgctggcagaagcccaaagtgtaggg
gcacatacgttaattacggtgggggctgtacaatccaatcattgtcgccaggtagcggcg
cttgccgcgcggatgggattgaagtgtaaactggtcctttatggagagatcccgtcgcgg
gcttcaggtaacctgtttttagaccgcctgtttggtgcagaaattttctggacgagcaag
gacgcccgcaatgaaactttgaacgaggtgtttggcgagtcctgggcacggggagagcgc
ccatacctcatcccgttaggcgcatccaaccctttaggggctgcggcatatgcactggca
tttgatgaaatgctgcagcaaatccagtctgagcgcgttgattggattgttgtggcttct
tcgtctggaggtacgcaggcgggtctggtcttgggtgcgcatcgacgccactttcatgga
cgcattttgggcatcagcatcgatgaacccgagcgagagttgaaggaggtggttgcgttt
ctggcacgtgaagcctccgatcgtttgggaaaagccatgactattcatccagaggatgtg
tttgtcaatgccgattatttggggggtggttatggggtgatgggtgaggcggaacgagaa
gccattaccctgtttgcacaactggaaggggtgttgctcgatccggtctacacgggaagg
gcggcggctggattgattgatctggcacgcaaaggcttctttcaccgcggtgaaaccatt
ttgttctggcataccggaggaaccccggcactttttgccgataaatatcaaaatcaattg
ctcagcgaatga

DBGET integrated database retrieval system