KEGG   Anaerolinea thermophila: ANT_22810Help
Entry
ANT_22810         CDS       T01410                                 

Gene name
gpmA
Definition
(RefSeq) 2,3-bisphosphoglycerate-independent phosphoglycerate mutase (EC:5.4.2.1)
  KO
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
atm  Anaerolinea thermophila
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:atm00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    ANT_22810 (gpmA)
   01230 Biosynthesis of amino acids
    ANT_22810 (gpmA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    ANT_22810 (gpmA)
  Energy metabolism
   00680 Methane metabolism
    ANT_22810 (gpmA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    ANT_22810 (gpmA)
Enzymes [BR:atm01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     ANT_22810 (gpmA)
Exosome [BR:atm04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   ANT_22810 (gpmA)
  Exosomal proteins of melanoma cells
   ANT_22810 (gpmA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
NITE: 
UniProt: 
Position
2519474..2520220
Genome map
AA seq 248 aa AA seqDB search
MIKLVLLRHGQSTWNLENRFTGWTDVDLSEQGIQEAHEAGRLLREAGYTFDIAFTSVLKR
AIRTLWIALDELDQMYIPIENAWQLNERHYGALQGLNKAEMAEKYGKEQVHLWRRSYNVP
PPPLDWDDPRHPRFDPRYAKVDPALLPACESLELTLKRVMPYWESEIVPRLKAGEKVLIA
AHGNSLRALVKHLDNMSDEDIVELNIPTGIPLVYELDDNLKPITHYYLGDPEKAKAAAEA
VAKQAEKK
NT seq 747 nt NT seq  +upstreamnt  +downstreamnt
atgattaaactcgttttactgcgccacggacaaagtacgtggaaccttgaaaaccgcttt
accggatggacagatgtggacctgtccgaacagggtatccaggaagcccatgaagccggg
cgtcttttgcgggaagccggttataccttcgatattgccttcacctcggttctgaaacgc
gccatccgcaccctgtggattgctcttgatgaattggatcaaatgtacattcccatcgag
aatgcctggcaattgaacgaacgacattatggcgctctgcaagggctgaacaaagccgaa
atggctgagaagtacggcaaggaacaggtgcacctctggcgccgcagttataacgtaccc
ccaccgcccctggattgggatgatcctcgccacccacgctttgacccacgctacgccaaa
gtggatccggctcttttacccgcctgcgaatcgctggaactaaccctgaagcgtgttatg
ccctactgggaaagtgaaattgtcccgcgccttaaagccggagaaaaagtgctcattgcc
gctcatggcaacagcctgcgcgctctggtcaaacatctggataatatgtccgatgaggac
attgtggaactgaacattcccaccggcatcccgctggtgtacgaactggatgacaacctg
aaacccatcacccactactatctgggcgatccagaaaaagccaaggccgccgctgaagcc
gttgccaagcaagccgagaagaaataa

DBGET integrated database retrieval system