KEGG   Anaerolinea thermophila: ANT_25810Help
Entry
ANT_25810         CDS       T01410                                 

Definition
putative alpha-galactosidase (EC:3.2.1.22)
Orthology
K07407  
alpha-galactosidase [EC:3.2.1.22]
Organism
atm  Anaerolinea thermophila
Pathway
Galactose metabolism
Glycerolipid metabolism
Sphingolipid metabolism
Class
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:atm00052]
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:atm00561]
Metabolism; Lipid metabolism; Sphingolipid metabolism [PATH:atm00600]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NITE: 
UniProt: 
Position
complement(2845150..2847222)
Genome map
AA seq 690 aa AA seqDB search
MLRESKGKTLMKPSSFAFGERGCSLIFEPCGVSLALKQLHGEKRAWLAVSQPSGLAGVQV
NGKRFTVEALKFLGRETDQPAPGVWQDVLSFEGEGWELQQVIRRYDGFPLVELEPRLINR
GNVEIVVERLDSLDLRLPSSGLTLLGYSGNWGSEFEPLQFKPYQPFVLESRFGRSSKGHH
PWMAMLSDEEEILVVSIAWSGNWVMRFDPLGGKILHFTAGLHDWLFSKRLQPDESFRGAP
LVLVTGEDLNVVSRHLARVGRQYWYPQNELSRRLPVEWNHWWPYEDVEINEEIFLANVHK
AAELGFEVCTLDAGWFGPAEAGTFWYDYRGDWHLVNSARFPHGIRYLADRVHALGMKFGI
WCEIEALGEKARLAVERPDLPALRDGNRLGYVCMGNPAAREWAYQTLSRLILEWGCDWIK
LDFNLDPGAGCNRTDHGHQEGDGLYEHYRGYYQVLTRIRRDFPHVVLENCSSGGLRIDLG
MMRQTHVTFLSDPDWAVHDLQIFWGASTMLAPNVLLHWTFSHWRNVDPPPQQRFNPHDPH
LTHQKWDYYSRISMLGWYGLSQKLPDLPGWLAERVAYHNRLYQTEIRRFIREGDLYRLSA
QPLRSGMGERWAVFQYAMPDESEHLLFIFRLPGGEPSYILRPVDLQPERLYRVYGFEGEG
EWHLSGRDLMEKGLSIDCLQEEESLLLKME
NT seq 2073 nt NT seq  +upstreamnt  +downstreamnt
atgctgagggaatcgaagggaaaaaccttgatgaaacctagttcttttgcttttggcgaa
cggggatgttccctgatctttgaaccttgcggggtttctctggctttgaagcagttgcat
ggggaaaaacgggcatggcttgcggtttctcaaccttccggtttggctggtgtgcaggtg
aacggcaaacgctttaccgtagaggcgttgaaattccttggcagagagactgatcaaccc
gctcccggggtgtggcaggacgtgctgtcctttgagggggaggggtgggagttgcaacag
gtcatccgaaggtacgatggctttccactggtggaattggagccgcgcctcatcaatcgg
ggaaatgtggagattgtagtggagcgcctcgattcgctggatttgagactgccatccagt
gggctgactcttctgggctacagcggcaactgggggagcgagtttgaaccgctccagttc
aagccttatcagccctttgtgctggaatcccgttttgggcgttcatccaaagggcatcat
ccctggatggcaatgctctccgatgaggaggagatccttgtggtgtccattgcctggtcg
ggaaactgggtgatgcgctttgatccgcttggcggaaagattctgcacttcacagcaggc
ttgcacgactggctcttttccaaacgtctccagccagacgagtccttcagaggggctcct
cttgttctggttacaggggaagatctgaacgtcgtttcgcgccatctggcgcgcgtggga
cgtcagtactggtatcctcagaatgaattgtcgcgtcgtttgccggtggagtggaatcac
tggtggccctatgaggacgttgagattaacgaggaaatcttcctggcgaatgtgcacaaa
gccgccgaattgggctttgaagtgtgcacgctggatgcaggctggtttggtcccgccgag
gcgggaaccttttggtacgattatcgtggcgactggcatctggtcaattcggcgcgtttc
cctcatggaattcgctaccttgctgatcgggttcatgcgctgggaatgaagttcggtatc
tggtgcgaaattgaagcccttggcgagaaagcccggctcgccgtagagcgtccggatttg
cctgctttgcgggatggcaaccgcctgggttatgtatgtatgggcaaccctgctgcccgg
gaatgggcgtatcagacgctttcccgcttgatactggaatgggggtgtgactggattaaa
ctcgacttcaacctcgaccccggcgcagggtgtaaccgtaccgatcacggtcaccaggaa
ggggatggcttgtatgagcactaccgcgggtattatcaggtgcttactcgtatccgccgg
gattttccccatgtggtgctggagaattgttcttccggtggcttgcgcatagatctggga
atgatgcgccagacgcacgtaactttcctttccgatcccgattgggcggtgcatgacctg
caaatcttctggggagccagcaccatgctggcacccaacgtgcttctgcactggacgttc
agtcactggcgcaatgtcgacccccctccgcaacagcgtttcaatcctcacgatcctcat
ctaacgcatcagaaatgggattactactcgaggatttccatgctgggctggtacgggctt
tcgcaaaaattgcccgatttgccgggttggctggcagagcgtgtggcttaccataaccgt
ctttatcaaacggaaatccgaagattcattcgtgaaggcgacctgtaccgtttgagtgca
cagccgctccgcagtggtatgggggaacgttgggcagtgttccagtatgccatgcccgat
gaaagtgaacatctccttttcattttccggttgcctggtggtgaaccgtcttacattctg
cgtccggttgacttacagcctgagcgtctttatcgagtgtatgggtttgagggcgaaggg
gaatggcacttatccggacgtgacttgatggaaaaaggattgagcatagattgcttacag
gaagaagagtcgctcttgcttaagatggagtga

DBGET integrated database retrieval system