KEGG   Anaerolinea thermophila: ANT_26290Help
Entry
ANT_26290         CDS       T01410                                 

Definition
putative glycosyl hydrolase (EC:3.2.1.-)
Orthology
K12308  
beta-galactosidase [EC:3.2.1.23]
Organism
atm  Anaerolinea thermophila
Pathway
Galactose metabolism
Brite
KEGG Orthology (KO) [BR:atm00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    ANT_26290
Enzymes [BR:atm01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     ANT_26290
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NITE: 
UniProt: 
Position
complement(2898979..2901285)
Genome map
AA seq 768 aa AA seqDB search
MAQFSVKQGQFWLDGKPLLLQAGEFHYFRTPPDQWEHRLNLLKQAGFNAVASYIPWLWHQ
PEPEWVDLDGHTHPMRNLQGFLDLASSMGLWIIPRPGPYIMAETINEGIPPWVFVRSPQV
ALIGQDGKPQNIVSYLHPDFLAWAREWYRAVFGVLVPRQVTRGGKILLVQLDNEMGMIHW
VRNLLDTHPDTLARFAAYLREKDTLPDNAPMDGLEEFLHRQLQNPDVEHGGWVVEEYRRF
YRTYLRQYAEWLVDCAHSFGLEVPPVINIHGFGNGGKTFPIGLSQLSEVMQIPGMLSATD
VYPLGIGEGNFHQLLLVNEMTRALHHPEQPLFSIEFQAGGNQDFGGAQTSFYDLHTRLCV
STGMRAINHYLFFDGENHPILSPVKRHDWGHPVRKDGTLRRHYHRYPRLSRVLQTYGEAL
TLAKPRTVTTIGFVLDDFMTEVNNSFTRLQTDVLTHQREVILFDFIARGLALTHRPFDAL
ELSRAPLDATRTPTLWVMMEKQCDVPVQHKLVEYVRQGGRLILAGRLCEEDFQHHPCTVL
KDALGIRAVHDAEPFRGETIHIMDVLDIPVSFVERFEGDFDEVFAHTVQGEIVGFVRSLG
KGRVMMLGAALAANTLEDLAVFERMAQRMECSPLFEMSDWLDVRLSEGEKGKFLFVNNYQ
DDPVEALISLSGKPLFGGEPVRLPARRGLILPLDWQVRPGLRVDDSTGEVTGVFETEDSL
ILQVEPTDSTMQLTLSGYRVAEGKTLGMSPSGQVRVRTYSGRIVLQKA
NT seq 2307 nt NT seq  +upstreamnt  +downstreamnt
atggcacaattttccgttaagcagggacaattctggctggatggtaaaccgttgcttttg
caggcaggggaatttcattatttccgcacaccgcccgatcaatgggaacaccgcctgaac
ctgctgaaacaagccggtttcaacgccgttgccagttacattccctggctgtggcatcag
cccgagcccgagtgggtggatttggacgggcacacccatcccatgcgaaatctgcagggt
ttcctggatctggcatcctcgatgggcctgtggatcatcccgcgtccgggaccgtacatc
atggcagagactatcaacgaggggatcccaccctgggtttttgtgcgctctccgcaggtg
gctttaattgggcaggacggcaagccgcagaacatcgtcagttacctgcacccggatttt
ctcgcgtgggcgcgggagtggtatcgcgcggtatttggggtgctggtgccgcgtcaggtc
acccgcgggggcaaaatcctgctggtgcagttggacaacgaaatgggcatgattcactgg
gtgcgcaatctgctggatacccatcccgacacactggcgcgttttgcggcatacctgcga
gagaaagataccttaccggacaacgcacccatggatggactggaggaatttctccaccgg
cagttacaaaaccccgatgtcgaacatggcgggtgggtggtagaagagtatcgtcgcttt
taccgcacatatttgcgccagtatgccgaatggctggtggactgcgcgcattctttcggt
ttggaagtaccgccggtgattaacattcacggctttggcaatggcggaaagactttcccc
atcgggctttctcaactgtccgaagtgatgcagattcccggcatgctcagcgccacggat
gtctatcctctggggattggagagggcaactttcatcaacttctactggtcaacgagatg
accagagccctgcaccatcccgaacagcctcttttctccatcgagtttcaggcgggcggg
aatcaggactttggcggcgcgcagacttcgttttacgatttgcacacccgcctgtgcgtg
tcgacgggcatgcgcgccatcaaccattatctgttttttgacggggagaatcatcccatc
ctcagcccggttaagcgccatgattgggggcatccggtgcgcaaggacggcaccctgcgc
cgccactatcaccgttatccgcgtctttcgcgggtgcttcagacatacggtgaggcgttg
acgctggcaaaaccccgcacggtgaccactatcgggtttgtgctggatgatttcatgacc
gaggtcaacaattccttcacccgtctgcagacggatgtgctgactcaccagcgcgaggtg
atactgtttgattttattgcccgcggtctggcgcttacgcatcgtcccttcgatgcgctg
gaactcagccgcgccccgctggatgccacccgcacccctacactgtgggtgatgatggaa
aaacagtgcgatgttcccgttcagcacaaactggtggagtacgttcggcagggggggagg
ctgattctggcagggcgcctgtgcgaggaagatttccagcatcatccctgcaccgtcttg
aaggatgccctggggatccgtgctgtgcatgatgctgaacctttccgcggcgagactatc
cacattatggatgtgctcgatatcccggtttcatttgtggagcgtttcgaaggcgatttc
gatgaggtatttgcccacacggttcagggggagatcgtgggctttgtccgttcgctgggc
aaaggcagggtgatgatgctgggtgcggcgctggcggcgaatacgctggaagacctggcg
gtttttgagcgcatggcacagcgcatggagtgctcgccgctgttcgagatgagcgactgg
ctggatgtgcgcctcagcgaaggggagaagggtaagttccttttcgtgaataactatcag
gatgacccggtggaagcgttaatctctttgagcgggaaaccattgtttggtggtgagcct
gtgcgcctgcccgcccgccgcgggttgattctgccactggactggcaggtgcgtcccggc
ttgcgcgtagatgattctaccggcgaggtgaccggggtatttgagacggaagacagcctt
atcttgcaggtcgagccaacggatagtaccatgcagttgaccctgagcggatatcgggtg
gcggaaggaaaaacgctgggtatgtccccttcgggacaggttcgggtgagaacgtattcc
ggcaggattgtcctgcagaaggcttag

DBGET integrated database retrieval system