KEGG   Anaerolinea thermophila: ANT_26710Help
Entry
ANT_26710         CDS       T01410                                 

Definition
fructose-1,6-bisphosphatase (EC:3.1.3.11)
Orthology
K01622  
fructose 1,6-bisphosphate aldolase/phosphatase [EC:4.1.2.13 3.1.3.11]
Organism
atm  Anaerolinea thermophila
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Gluconeogenesis, oxaloacetate => fructose-6P
Class
Metabolism; Overview; Carbon metabolism [PATH:atm01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:atm01230]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:atm00010]
Metabolism; Carbohydrate metabolism; Pentose phosphate pathway [PATH:atm00030]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:atm00051]
Metabolism; Energy metabolism; Methane metabolism [PATH:atm00680]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NITE: 
UniProt: 
Position
2947509..2948627
Genome map
AA seq 372 aa AA seqDB search
MSEKLTLSVIKADVGGFVGHSAIHPDLIDTARMALEEARQKGWLIDFHVTACGDDLQLIM
THSRGVDDVEIHHLAWQVFERCTAIARKLKLYGAGQDLLTDAFSGNVRGMGPGVAEMELH
ERESEPVIIFMADKTSAGAWNLPLFRMFADPFNTAGLVISPSMHEGFRFEVHDVKQHKRI
FFDTPAEMYDLLVFIGASGRYVIKAVYTRDGEIGAVSSTQRLALIAGKYVGKDDPVCIVR
SQGKFPAVGEVLEPFTMPHIVEGWMRGSHYGPLMPVPVRQATPSRFDGPPRVAALGFQLA
NGGLIGPRDLFDDPGFDEVRRQVNVLADQLRRHGAFEPHRLPMDEMEYTTLPQVMEKLAE
RWEALPDEPVSV
NT seq 1119 nt NT seq  +upstreamnt  +downstreamnt
atgtccgaaaaactcactctgagcgtgattaaagccgatgtaggcggttttgtgggacat
tctgccattcatcccgacctgatcgataccgcccgcatggctcttgaggaagcccggcag
aagggctggctgatcgacttccatgtcaccgcctgcggagacgacctgcagttaatcatg
actcactcccgcggcgtggatgacgtggaaattcaccatctggcatggcaggtcttcgag
cgctgtaccgctattgccaggaaattgaaactctacggcgcaggacaggacctgctcacc
gatgccttctcgggcaacgtacgcggcatgggacccggtgtggcggagatggaactgcac
gaacgcgaatctgaaccggtcatcatcttcatggcagataagacctcagccggtgcctgg
aatctcccattgttccgcatgtttgccgaccccttcaacaccgccgggctggtgatttct
cccagcatgcacgaaggcttccgctttgaggtacacgatgtgaaacagcacaaacgcatc
ttctttgacacccccgccgagatgtacgacctgctggtgttcatcggcgcgtccggacgc
tatgttatcaaggcggtgtacacccgcgatggcgagattggcgcggtttcgtccacccag
cgcctggcattgattgccggcaagtacgtgggcaaggatgacccggtgtgcatcgtacgc
agtcagggcaagtttcccgcagtgggcgaagtactggagcctttcaccatgccgcacatc
gtggaaggctggatgcgcggctcgcactacggaccgctgatgcccgtgccggtacgtcag
gcaacccccagccgctttgacggtccgcccagggtggcggcgctgggcttccaactggca
aacggcggactcatcggcccgcgcgatttattcgacgacccgggttttgatgaagtgcgc
cgtcaggtcaacgtgctggcagatcaactgcgccgccatggcgctttcgaaccgcaccgc
ctgccgatggacgaaatggaatacaccaccctgccgcaggtgatggaaaaactggcagaa
cgctgggaagccctgcccgatgagccagtgagtgtgtaa

DBGET integrated database retrieval system