KEGG   Anaerolinea thermophila: ANT_26830Help
Entry
ANT_26830         CDS       T01410                                 

Definition
(RefSeq) phosphoglycerate mutase family protein
  KO
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
atm  Anaerolinea thermophila
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:atm00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    ANT_26830
   01230 Biosynthesis of amino acids
    ANT_26830
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    ANT_26830
  Energy metabolism
   00680 Methane metabolism
    ANT_26830
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    ANT_26830
Enzymes [BR:atm01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     ANT_26830
Exosome [BR:atm04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   ANT_26830
  Exosomal proteins of melanoma cells
   ANT_26830
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
NITE: 
UniProt: 
Position
complement(2958626..2959258)
Genome map
AA seq 210 aa AA seqDB search
MGRVLYSVTFLRHGRSCADDEGVYEGRYDSPLTAVGEAQAYRRAREWKECGVTFDRVIAS
TLQRARRTAEIVCEVLNLPLETSEAWMEINSGKLAGMNPQEAERIYPRPAFRNPYETITP
TGESEWQVFIRVAQALEEVIRQRVPRTLVVAHGGSLSMTLRVICGVTPWGNSQGVAFHLG
DLGFARTAYDPQTNVWHFLELHPGLQEIEQ
NT seq 633 nt NT seq  +upstreamnt  +downstreamnt
atgggacgagttctctattcggtgacgtttttacggcacggacgttcctgcgccgacgat
gagggagtgtacgaaggacgctatgattccccgctgaccgccgtcggcgaagcccaagcc
taccgccgcgcccgcgagtggaaagaatgcggagttaccttcgaccgggtcattgccagc
acgcttcagcgcgcgcgccgcaccgccgagattgtctgcgaggtgctgaacctgcccctg
gagacttccgaggcgtggatggaaatcaacagcggcaaactggctggcatgaatccgcag
gaagccgagcgcatctacccccgtccagcgttccgcaatccctacgagaccattaccccc
accggagagagcgagtggcaggtcttcatccgcgtggcgcaggcgctcgaagaggtgatt
cgtcagcgtgtgccgcgcacgctggtggtagcccacggcggttcactgtccatgaccctg
cgagtcatttgcggggtgaccccatggggaaacagccagggggtagcatttcaccttggc
gatttgggctttgcgcgcacggcttacgatccgcagaccaatgtctggcattttttggaa
ctgcatcccggcttgcaagagattgagcagtaa

DBGET integrated database retrieval system