KEGG   Anaerolinea thermophila: ANT_26830Help
Entry
ANT_26830         CDS       T01410                                 

Definition
(GenBank) phosphoglycerate mutase family protein
  KO
K01834  2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
atm  Anaerolinea thermophila
Pathway
atm00010  Glycolysis / Gluconeogenesis
atm00260  Glycine, serine and threonine metabolism
atm00680  Methane metabolism
atm01100  Metabolic pathways
atm01110  Biosynthesis of secondary metabolites
atm01120  Microbial metabolism in diverse environments
atm01130  Biosynthesis of antibiotics
atm01200  Carbon metabolism
atm01230  Biosynthesis of amino acids
Module
atm_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
atm_M00002  Glycolysis, core module involving three-carbon compounds
atm_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:atm00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    ANT_26830
  Energy metabolism
   00680 Methane metabolism
    ANT_26830
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    ANT_26830
Enzymes [BR:atm01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     ANT_26830
Membrane trafficking [BR:atm04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    ANT_26830
Exosome [BR:atm04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   ANT_26830
  Exosomal proteins of melanoma cells
   ANT_26830
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1 DUF3669
Motif
Other DBs
NCBI-ProteinID: BAJ64709
NITE: ANT_26830
UniProt: E8N0G0
Position
complement(2958626..2959258)
Genome map
AA seq 210 aa AA seqDB search
MGRVLYSVTFLRHGRSCADDEGVYEGRYDSPLTAVGEAQAYRRAREWKECGVTFDRVIAS
TLQRARRTAEIVCEVLNLPLETSEAWMEINSGKLAGMNPQEAERIYPRPAFRNPYETITP
TGESEWQVFIRVAQALEEVIRQRVPRTLVVAHGGSLSMTLRVICGVTPWGNSQGVAFHLG
DLGFARTAYDPQTNVWHFLELHPGLQEIEQ
NT seq 633 nt NT seq  +upstreamnt  +downstreamnt
atgggacgagttctctattcggtgacgtttttacggcacggacgttcctgcgccgacgat
gagggagtgtacgaaggacgctatgattccccgctgaccgccgtcggcgaagcccaagcc
taccgccgcgcccgcgagtggaaagaatgcggagttaccttcgaccgggtcattgccagc
acgcttcagcgcgcgcgccgcaccgccgagattgtctgcgaggtgctgaacctgcccctg
gagacttccgaggcgtggatggaaatcaacagcggcaaactggctggcatgaatccgcag
gaagccgagcgcatctacccccgtccagcgttccgcaatccctacgagaccattaccccc
accggagagagcgagtggcaggtcttcatccgcgtggcgcaggcgctcgaagaggtgatt
cgtcagcgtgtgccgcgcacgctggtggtagcccacggcggttcactgtccatgaccctg
cgagtcatttgcggggtgaccccatggggaaacagccagggggtagcatttcaccttggc
gatttgggctttgcgcgcacggcttacgatccgcagaccaatgtctggcattttttggaa
ctgcatcccggcttgcaagagattgagcagtaa

DBGET integrated database retrieval system