KEGG   Anaerolinea thermophila: ANT_27940Help
Entry
ANT_27940         CDS       T01410                                 

Definition
putative esterase (EC:3.1.-.-)
Orthology
K03928  
carboxylesterase [EC:3.1.1.1]
Organism
atm  Anaerolinea thermophila
Brite
Enzymes [BR:atm01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.1  carboxylesterase
     ANT_27940
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NITE: 
UniProt: 
Position
complement(3083853..3084635)
Genome map
AA seq 260 aa AA seqDB search
MNQPNLHNPHLNGEPFFWQAGPIGILMIHGFTATPVEVRMVAERLHPHGYTVAAPLLPGH
GTHPDDLNRVRWQDWVAKAEESYQQLKQTCQKVYLLGESMGALVALYLAAEHREAEGVIA
SAPAIRLLISPLQKAALPLLSLFKASMPKGGLDASSNWQGYPVNPLKGVQQLFRFQKEVE
RRLPEIVQPILVLMGRYDTTVHPEAGKFILERVSSPYKSLVWFENSSHVILIDQEVDAAA
ERIERFIKETSNDGMPALLS
NT seq 783 nt NT seq  +upstreamnt  +downstreamnt
atgaatcaacccaatttgcacaacccccacctcaatggcgagccgttcttctggcaagcc
ggtcccattggcattctgatgattcacggtttcaccgccacgccggtggaagtgcgcatg
gtcgccgagcgcctgcacccgcatggctacacggttgccgcgccgcttttacctggtcac
ggcacacaccccgatgacctgaatcgagtccgctggcaggattgggttgctaaagccgaa
gaatcctaccagcagttgaagcaaacctgccagaaagtctatttgctgggtgaatccatg
ggcgcattggtggcgttgtatctggcggcagagcaccgtgaagccgaaggggtcattgct
tcagcccctgccatccgcctgcttatttcgccattgcagaaagccgctctgccgttgctc
agccttttcaaggcttccatgcccaaaggtgggctggatgcttcctcgaactggcagggc
tatccggtcaacccgttgaaaggggtacagcagttattccgcttccagaaagaagtggag
cgccgtttgcccgaaatcgtccagcctattctggtgctgatgggacggtacgataccacc
gtccaccccgaggcgggaaagttcatcctggagcgggtttcatcaccctataaatcgctg
gtgtggtttgagaactccagccacgtgattttgattgatcaggaagtagatgccgccgct
gagcgtattgagcgatttattaaggaaacctcgaatgacggcatgcctgccctgctgagt
tag

DBGET integrated database retrieval system