KEGG   Anaerolinea thermophila: ANT_29690Help
Entry
ANT_29690         CDS       T01410                                 

Definition
ABC transporter ATP-binding protein
Orthology
K02010  
iron(III) transport system ATP-binding protein [EC:3.6.3.30]
Organism
atm  Anaerolinea thermophila
Pathway
ABC transporters
Module
Iron(III) transport system
Class
Environmental Information Processing; Membrane transport; ABC transporters [PATH:atm02010]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NITE: 
UniProt: 
Position
complement(3288640..3289689)
Genome map
AA seq 349 aa AA seqDB search
MIALSLHHVSRTFAQNPRPAVDDLSLDLPAGQILALVGPSGCGKTTTLRLIAGLECPDRG
KIFINGRLMASSLVFVPPERRGVGMVFQDHALFPHLTVFDNVAFGLRGKPRTQVRQTVHA
MLEMVGLQALAGRYPHALSGGERQRVALARALAPRPVLVLMDEPFSSLDADMRLEMREQV
RGILKEMGATVVFVTHDQEEALFMGDRLAVFREGRMEQLGTPEEIFHASTSRFVAEFMGD
SDFLPGSVVHEGIHTPLGVIAQPLSLPAGTPVEIALRADDVDFVPDGQNGNAVIVERFFR
GAFHVYRLRLESGEVLHAFKEHTLVLPAGMRVRARISAEHPLIVFPKRA
NT seq 1050 nt NT seq  +upstreamnt  +downstreamnt
atgatcgcgctttctcttcatcatgtctctcgaacctttgctcaaaacccccgtccagca
gtggatgatctctcactggaccttcccgccggtcaaattctggcgctggtgggtcccagc
ggatgcgggaaaaccaccaccctgcgcctcatcgccgggctggaatgccccgatcggggg
aagattttcatcaatggacggctgatggcgtcttcgctggtgttcgtccccccagaacgg
cgcggcgtggggatggtctttcaggatcatgccctctttccccacctgacggtgtttgac
aacgttgcttttggcttacgcggcaaaccgcgcacccaggtgcgccaaaccgtacatgcc
atgctggagatggttggactgcaagccctggcagggcgttacccccatgcgctttcgggg
ggagaacgccagcgggtagccctggcgcgcgccctggcgccgcgtcccgtgctggtgctg
atggatgaacccttcagcagtctggacgccgacatgcgtctggagatgcgcgagcaggtg
cgcgggattttgaaagagatgggtgccacggtggtctttgtcacccacgaccaggaagaa
gctcttttcatgggcgaccgtctggcagtcttccgtgaagggcgtatggagcagttgggc
acgcccgaagagattttccatgcctcgacgtcccgttttgtagccgagttcatgggcgat
agcgacttcctgcccggctcggtagtccatgaaggcattcacacgccgttgggtgtgatt
gcccagccgctttccctgcctgccggcacgccggtggagattgccctgcgcgccgacgac
gtggattttgttcccgacggacaaaacggcaacgcggtcattgtcgagcgcttcttccgt
ggagccttccatgtctatcgtctgcgcctggagagtggcgaggtgctgcatgccttcaaa
gagcataccctggtgcttcccgccggtatgcgcgtgcgggcgcgcattagcgctgaacac
ccgctgattgtctttccaaagagagcctga

DBGET integrated database retrieval system