KEGG   Anaerolinea thermophila: ANT_29780Help
Entry
ANT_29780         CDS       T01410                                 

Definition
beta-galactosidase (EC:3.2.1.23)
Orthology
K12308  
beta-galactosidase [EC:3.2.1.23]
Organism
atm  Anaerolinea thermophila
Pathway
Galactose metabolism
Class
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:atm00052]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NITE: 
UniProt: 
Position
complement(3297012..3298763)
Genome map
AA seq 583 aa AA seqDB search
MSTLTIEGDHFELDGEPFRILAGAMHYFRVHPAYWKDRLLKLKAMGLNTVETYVAWNLHE
PHEGEFHFGDWLNIERYIELAGELGLYVIVRPGPYICAEWEMGGLPAWLLKDPQMKLRCM
YQPYLDAVGEYFSQLMHRLVPLQSTRGGPIIAMQVENEYGSYGNDTRYLKYLEELLRQCG
VDVLLFTADGVADEMMQYGSLPHLFKAVNFGNRPGDAFEKLREYQTGGPLLVAEFWDGWF
DHWGERHHTRSAGEVARVLDDLLSEGASVNLYMFHGGTNFGFMNGANAFPSPHYTPTVTS
YDYDAPLSECGNITPKYEAMREVIGKYVDLPEMPDFPPVVRHAYGKVQLDEWAPLLSQVD
VLSTPEYSTVPLPMEMYDQNYGFILYETQLSGPREEARLIIRGLHDRGHVFVDNELIGIV
DRENHAKPLSFSVQDQGVRLHILVENMGRVNYGPDLADRKGITEGVLLGQQWLFGWTVYP
LPLEDLSAIRYLPGEPEEFPAFLRGTWTINGTPADTFLALPGWTKGVVWINGFNIGRYWK
RGPQKTLYVPAPLLKEGENEIVVLELDDLHHPVVEFRNHAELG
NT seq 1752 nt NT seq  +upstreamnt  +downstreamnt
atgtccactttaacaatcgagggtgaccattttgagttagacggagagccctttcgtatt
cttgccggggcaatgcattacttccgcgtccacccggcgtactggaaagaccgtctgctc
aagctcaaagccatggggctgaacacggttgagacttacgttgcctggaatctgcatgag
ccccatgagggggaatttcactttggcgactggttgaacattgagcgttatatcgaactg
gcaggcgaactggggctttacgtcatcgtgcgcccgggtccatacatctgtgccgagtgg
gagatgggcggtctgcctgcctggctgctcaaagacccgcagatgaaactgcgctgtatg
tatcaaccctacctggatgccgtcggggagtacttcagccagttgatgcaccgtttggtg
cccctgcaaagcacccgaggaggtcccatcatcgccatgcaggtggaaaatgagtatggc
agttacggcaacgatacccgctacctgaaatatctggaagaacttctgcgccagtgtggg
gtggatgtcttgctcttcaccgccgatggcgttgccgatgagatgatgcagtatggcagt
ctgccgcacctcttcaaggcagttaactttggcaatcgtcccggcgatgctttcgaaaaa
ctgcgcgagtaccagacgggcggtcctttgctggtagccgaattttgggacggttggttt
gatcactggggagagcgccaccatacccgttcggcgggagaggttgcccgggtgctggac
gatttactctccgagggggcttcggtgaacctgtacatgttccacgggggcaccaatttt
ggcttcatgaacggcgccaatgccttcccttctccccattacacccccacggtgaccagt
tatgactacgacgccccgcttagcgagtgcggcaacatcacccccaagtacgaagccatg
cgcgaggtcattggcaaatacgtggatttgcccgaaatgcccgattttccgccggtagtc
aggcatgcctacggtaaggtacaactggacgagtgggcgcccctgctgagtcaggtggat
gtgctttccactcccgaatacagcaccgttcccctgccgatggagatgtacgaccagaat
tacggcttcatcctctacgaaactcaactgagcggaccgcgcgaggaagcccgcctgatc
atccgcggactgcacgaccgcgggcatgtttttgtggataatgaactcatcggcattgtc
gaccgcgagaaccatgccaaaccgctgtcgttctcggtgcaggatcagggagtgcgcctg
cacatcctggtggaaaacatggggcgggtcaactatggtcccgaccttgccgaccgcaag
ggcatcaccgagggggttttgctgggacagcagtggctctttggctggacggtgtatccc
ctgccgctggaagacctctccgccatccgctatctgcccggcgagccggaggaatttccg
gcgttcctgcgtggcacctggacaattaacggcacacccgccgatactttccttgccctg
cccggttggaccaaaggcgtagtgtggattaacggctttaacattgggcgatactggaag
cgcggaccgcaaaagacgctgtacgtgcctgcccctctgcttaaagagggagagaacgaa
attgtagtgctggaactggacgacctgcaccatccggtggtggaatttcgcaatcatgcg
gagttaggatga

DBGET integrated database retrieval system