KEGG   Anaerolinea thermophila: ANT_30140Help
Entry
ANT_30140         CDS       T01410                                 

Definition
(GenBank) putative alpha-galactosidase
  KO
K07406  alpha-galactosidase [EC:3.2.1.22]
Organism
atm  Anaerolinea thermophila
Pathway
atm00052  Galactose metabolism
atm00561  Glycerolipid metabolism
atm00600  Sphingolipid metabolism
Brite
KEGG Orthology (KO) [BR:atm00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    ANT_30140
  Lipid metabolism
   00561 Glycerolipid metabolism
    ANT_30140
   00600 Sphingolipid metabolism
    ANT_30140
Enzymes [BR:atm01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.22  alpha-galactosidase
     ANT_30140
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_4 Glyco_hydro_4C NAD_Gly3P_dh_N
Motif
Other DBs
NCBI-ProteinID: BAJ65040
NITE: ANT_30140
UniProt: E8N293
Position
complement(3342530..3343876)
Genome map
AA seq 448 aa AA seqDB search
MKKTIVLIGAGSAQFGYGTIGDILQSKVLEGSHIVLHDINPTTMGVVERTARQFIEEHGL
PFTISATTNRAEALQGADFVISSIEVGDRFELWEQDWRIPQQYGIRQVYGENGGPGGLFH
SLRIIPPILDIVADVMRICPDAYVFNFSNPMSRICTTVHRAFPDAKFIGLCHEIGSLRRF
LPEILGVPYEALEVRAGGLNHFSVVLSAKYKDTGKDAYPDIRAKAPAFFANMPSLSAEHK
YFKETGKWPETKEDFAHVETEAWPERRVFQVILEKFGLMPITSDSHFGEYIQWAYDVTDH
RGILDFYRFYKQYLSTVQPKIELTLKERVVPIIEGILTDAGYVEEAVNIPNKGLIDDLPE
WIAVEVPAIVDKNGVHGIPLGKLPAGFKGLLMNQVAVHDLTAEAVIHKSKALALQALMVD
PVVDIYQGLEELLDTMIEYQEKWLGYLK
NT seq 1347 nt NT seq  +upstreamnt  +downstreamnt
atgaagaaaacgattgttctcattggagccggaagcgctcagttcggttatggcaccatt
ggcgatattctgcagagcaaggtcctggaaggcagtcacatcgttctgcacgatattaac
cctaccaccatgggcgtggtggagcgcactgcccgccagtttatcgaagagcacggtttg
ccgtttaccatttctgccaccaccaaccgcgccgaagccctgcagggcgccgatttcgtc
atcagttccatcgaagtgggcgaccgcttcgaattgtgggagcaggactggcgcatccct
cagcagtacggcatccgccaggtgtatggcgaaaacggcggtccgggcggcttgttccac
tccctgcgcatcatccccccgattctggacatcgttgccgatgtgatgcgcatctgcccg
gatgcctacgtgttcaacttctccaacccgatgagccgcatctgcaccaccgtgcaccgt
gccttccccgatgccaaattcatcggcctgtgccatgagattggctctctgcgccgcttc
ctgcccgaaattctgggcgtgccgtacgaggcgctggaagtgcgcgcgggcggcttgaac
cacttcagcgtggtgctttcggcaaagtacaaggataccggcaaggatgcctaccccgat
atccgcgccaaagccccggcgttctttgccaacatgccgtcgctcagcgccgagcacaag
tacttcaaggaaaccggcaaatggcccgagaccaaagaggactttgcccacgtggagacc
gaagcctggcccgagcggcgcgtcttccaggtcattctggaaaaattcgggctgatgccc
atcacctccgacagccactttggcgagtacatccagtgggcgtacgatgtcaccgatcac
cgcgggattctggacttctaccgcttctacaagcagtacctgtccaccgtccagcccaag
attgaactgaccctcaaagagcgcgtggtgccaattattgaaggcatcctcaccgatgcg
ggctacgtggaagaagccgtcaacatccccaacaagggcttgattgacgacctgcccgag
tggattgccgtggaagtgcccgctatcgtggacaagaacggcgtgcatggcatcccgctg
ggcaaactgcccgccggtttcaagggcttgctgatgaatcaggtggctgtccacgacctg
accgccgaagccgtgattcacaagtccaaagccctggctctgcaggcgctgatggtagat
ccggtggtggatatctaccagggcttggaagaactgctcgacacgatgattgagtatcag
gaaaagtggctgggctacctgaaataa

DBGET integrated database retrieval system