KEGG   Amborella trichopoda: s00001p00189490Help
Entry
s00001p00189490   CDS       T02990                                 

Gene name
AMTR_s00001p00189490
Definition
hypothetical protein
Orthology
K05277  
leucoanthocyanidin dioxygenase [EC:1.14.11.19]
Organism
atr  Amborella trichopoda
Pathway
Flavonoid biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Flavonoid biosynthesis, naringenin => pelargonidin
Brite
KEGG Orthology (KO) [BR:atr00001]
 Metabolism
  Biosynthesis of other secondary metabolites
   00941 Flavonoid biosynthesis
    s00001p00189490 (AMTR_s00001p00189490)
Enzymes [BR:atr01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.11  With 2-oxoglutarate as one donor, and incorporation of one atom of oxygen into each donor
    1.14.11.19  leucocyanidin oxygenase
     s00001p00189490 (AMTR_s00001p00189490)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Unknown
AA seq 327 aa AA seqDB search
MCDVFKLEKAVEGPQIPVIDMKGLWCGNNEEREKVEREISEAAREWGVMQVLNHGIPEEF
IEKLKAAGKTFFDLPIEEKELYANDQASGKIDGYGSKLANNKSGQLEWEDYFFHLLYPES
KRNMSIWPKNPTDYVEVTDAYGKELRKVVTTILAILSVGLGVEPDRLDRELGGLDDLLMQ
LKINYYPKCPQPDLALGVEAHTDISALTLLLHNMVPGLQLWYKGKWVTAKCIPGALIVHI
GDSLEILSNGRYQSGLHRGLVNKEKVRISWAVFCEPPKEQLLQPLKELVSETEPAKFPPR
TFAQHIQYKLFRKTQEKAAAAEANGKN
NT seq 984 nt NT seq  +upstreamnt  +downstreamnt
atgtgtgatgtgttcaagttggaaaaagcggtggaaggtcctcaaatccctgtaattgac
atgaagggtttgtggtgtggaaacaatgaagagagagaaaaggttgagagagaaataagt
gaggctgcaagagagtggggagtgatgcaagtgctcaaccatggcatccctgaggagttc
atagagaagctcaaggcagctggtaagaccttctttgacctccccattgaagaaaaggaa
ttgtatgccaatgatcaagcctctggtaaaattgatggctatgggagcaaactagccaac
aataagagtgggcagcttgagtgggaggactattttttccacttgctttatcctgagagc
aagagaaacatgtctatttggcccaagaacccaaccgactatgtggaggtgaccgacgcc
tatggcaaggagctgcgcaaggtggtgaccaccatcctcgccatcctatcggtcggcctc
ggcgtggagccagaccgcctcgaccgcgagctcggtggtctcgacgacctcctcatgcag
ctgaaaatcaactactacccaaaatgcccacaacccgacctggccctgggcgtagaggcc
cacactgacataagcgccctaactctcctcctccacaacatggtccccggactccagctg
tggtacaagggcaaatgggtgactgcaaaatgcatccctggcgctctcattgttcacatt
ggggattcattggagatattgagcaatgggaggtatcagagtgggcttcacaggggcctg
gtgaacaaggagaaggtcaggatttcctgggcggtgttttgcgagcccccgaaggagcag
ctgctgcagccgctcaaagagttggtgagcgagaccgagcccgccaagttcccgccgcgc
acctttgcccagcacattcagtataagctcttcaggaagacgcaggagaaggccgccgcc
gctgaggccaatggcaaaaattga

DBGET integrated database retrieval system