KEGG   Amborella trichopoda: s00011p00215690Help
Entry
s00011p00215690   CDS       T02990                                 

Gene name
AMTR_s00011p00215690
Definition
hypothetical protein
Orthology
K13082  
bifunctional dihydroflavonol 4-reductase/flavanone 4-reductase [EC:1.1.1.219 1.1.1.234]
Organism
atr  Amborella trichopoda
Pathway
Flavonoid biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Flavonoid biosynthesis, naringenin => pelargonidin
Brite
KEGG Orthology (KO) [BR:atr00001]
 Metabolism
  Biosynthesis of other secondary metabolites
   00941 Flavonoid biosynthesis
    s00011p00215690 (AMTR_s00011p00215690)
Enzymes [BR:atr01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.219  dihydrokaempferol 4-reductase
     s00011p00215690 (AMTR_s00011p00215690)
    1.1.1.234  flavanone 4-reductase
     s00011p00215690 (AMTR_s00011p00215690)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Unknown
AA seq 118 aa AA seqDB search
MYFVSKTLAERAALDFGEENNLEVITIVPPFIIGPFIMQNMPSSVHSALSPITREEAHYA
YLKQHCLIHVDDLCTAQIFLFEHPAAKGRYICSSHDNTIFQLAEMMRERYPEYDIPTE
NT seq 357 nt NT seq  +upstreamnt  +downstreamnt
atgtattttgtgtccaagacactggctgagagagctgcattggactttggagaagaaaat
aatttggaggttattaccattgtacctcccttcataattgggcccttcattatgcaaaat
atgccctcaagcgttcactctgccttatctccaatcacaagggaggaagctcactatgcc
tatttgaagcaacattgtttgatacatgttgatgacttatgtactgctcaaatcttcctc
tttgagcatcctgcggcaaaaggaagatacatttgctcctcacatgataacaccatcttt
caattggccgaaatgatgagggagagatacccagagtatgacatccctacagagtaa

DBGET integrated database retrieval system