KEGG   Amborella trichopoda: s00021p00059810Help
Entry
s00021p00059810   CDS       T02990                                 

Gene name
AMTR_s00021p00059810
Definition
hypothetical protein
Orthology
K01595  
phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
atr  Amborella trichopoda
Pathway
Pyruvate metabolism
Carbon fixation in photosynthetic organisms
Metabolic pathways
Carbon metabolism
Module
CAM (Crassulacean acid metabolism), dark
C4-dicarboxylic acid cycle, phosphoenolpyruvate carboxykinase type
C4-dicarboxylic acid cycle, NAD - malic enzyme type
C4-dicarboxylic acid cycle, NADP - malic enzyme type
Brite
KEGG Orthology (KO) [BR:atr00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    s00021p00059810 (AMTR_s00021p00059810)
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    s00021p00059810 (AMTR_s00021p00059810)
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    s00021p00059810 (AMTR_s00021p00059810)
Enzymes [BR:atr01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     s00021p00059810 (AMTR_s00021p00059810)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Unknown
AA seq 965 aa AA seqDB search
MSKNSLVKLASIDAQLRLLVPAKVSEDDKLVEYDALLLDRFLDVLQDLHGEDLRETVQEC
YEHSAEYEGKHDPRKLEELGSVLTSLDPGDSIVVASSFSHMLNLANLAEEVQIAYRRRIK
LKKGDFADENSATTESDIEETLKRLVVQLKKSPEEVFDALKNQTVDLVFTAHPTQSIRRS
LLQKHARIRNCLTQLYAKDITPDEKQELDEALQREIQAAFRTDEIRRTPPTPQDEMRAGM
SYFHETIWKGVPKFLRRVDTALKNIGINERVPYNAPLIQFSSWMGGDRDGNPRVTPEVTR
DVCLLARMMAANLYFSQIEDLMFELSMWRSTDELRVRAHELHSSSRKDAKHYIEFWKQIP
PNEPYRVILGDVRDKLYNTRERSRHLLASGTSDIPEEATYTNLEQFLEPLELCYRSLCSV
GDRPIADGSLLDFMRQVSTFGLSLVRLDIRQESDRHTDVMDAITQHLGIGSYREWSEEQR
QEWLLLELRGKRPLFGPDLPKTEEITDVLDTFHVISELPSDSFGAYIISMATSPSDVLAV
ELLQRECRVKNPLRVVPLFEKLDDLEAAPAALARLFSIDWYLNRINGKQEVMIGYSDSGK
DAGRLSAAWALYKAQVELINVAKQYGVKLTMFHGRGGTVGRGGGPTHLAILSQPPDTIHG
SLRVTVQGEVIEQSFGEEHLCFRTLQRFTAATLEHGMRPPISPKPEWRALMDEMAVVATE
EYRSIVFKEPRFVEYFRLATPELEYGRMNIGSRPSKRKPSGGIESLRAIPWIFAWTQTRF
HLPVWLGFGAAFKHVLQKDIRNLHMLQEMYNEWPFFRVTIDLVEMVFAKGDPGIAALYDK
MLVSEDLWSFGEKLRVHYEETKSLLLQVAAHKDLLEGDPYLKQRLRLRDSYITTLNVCQA
YTLRRIRDPSYSVKVRPHLSKEIVDSSKPAAELVKLNPTSEYAPGLEDTLILTMKGIAAG
LQNTG
NT seq 2898 nt NT seq  +upstreamnt  +downstreamnt
atgtcgaagaactcgttagtaaagcttgcatcaattgatgcgcagttgaggctccttgta
cctgcaaaggtctctgaggatgacaaattagttgaatatgatgctctcctcttggatcga
tttctcgacgtccttcaggatctacatggagaagatctaagggagacggttcaagagtgc
tatgagcattctgctgagtatgaggggaagcatgaccctcgaaagttggaagagctgggg
agtgtgttgactagtttggatcctggggattccattgttgttgctagctccttctcacac
atgcttaacttggccaacttggccgaagaggttcagattgcttataggaggaggatcaag
cttaagaagggagactttgctgatgagaactctgcaacaaccgaatctgacattgaggag
actctgaagaggttggtggttcagctgaagaagtcccctgaagaagtttttgatgcgctg
aagaaccagactgttgatctggtcttcacagcccaccccactcagtcgatccgaaggtca
ctgcttcagaagcatgcgaggatacggaattgtttgacccagttgtatgccaaggacatc
actcctgatgagaagcaggagcttgatgaagctctacagagagagattcaagctgcattt
cgaactgatgaaatccgccgaactcctccaactccacaagacgaaatgcgtgctgggatg
agttatttccatgaaacaatatggaaaggtgtccccaagtttttgcgtcgggttgacact
gctttgaagaatatagggattaatgaacgcgtgccatataatgcccctctcattcaattt
tcatcttggatgggaggtgaccgtgatggaaaccccagagtaactcctgaggttacaagg
gatgtgtgcttgctggcacgaatgatggctgctaatctgtacttttctcaaattgaggat
cttatgttcgagttgtccatgtggcgttccactgatgagcttcgtgttcgtgctcatgag
ctgcatagttcttcgaggaaagatgcgaagcattatatcgagttctggaaacaaattcct
cctaacgagccctaccgtgttatactcggagatgtaagggacaaactctataacactcgt
gagcgttcacgccacttgttagcaagtggaacatccgatattcctgaggaagcaacatat
accaacctggaacagttcctagaaccccttgagctctgttaccgatctttatgttcagtg
ggtgaccgacccattgcagatggaagcctcctcgacttcatgcgccaggtatccacgttt
ggcctctcccttgtgagactcgacataaggcaagagtcggatcgccacaccgatgtcatg
gatgcgatcactcagcacctcggcattgggtcataccgagaatggtccgaggaacagcgc
caagagtggcttttgttggagctgaggggaaaacgcccactattcggtcctgatctcccc
aagaccgaggagatcaccgacgtcttggacacattccatgtcatatctgagctcccatct
gatagttttggggcctacatcatctcaatggctacttcaccatcagatgtgcttgcagtt
gagctcttgcaacgagagtgtcgagtaaagaatcctttgagagttgtgcctcttttcgag
aagctagatgatctagaggctgcccctgctgcacttgcaaggctcttctcaattgattgg
tatcttaaccgaataaatgggaagcaagaggttatgattgggtattcagattcaggcaag
gatgctggtcgtctctctgctgcgtgggcgctttataaggctcaggttgagcttataaat
gtagcaaagcaatatggagtgaagcttactatgtttcatgggcgagggggcacagtggga
aggggtggtggcccaactcatcttgctatattgtctcagccacctgatacaattcatggg
tcactaagggtgacggtgcaaggagaggttatagagcagtcattcggtgaggagcatcta
tgctttaggaccttgcagaggttcaccgcggccacgcttgagcatggtatgcgccctcca
atctcaccgaagccagagtggcgagccttgatggacgagatggctgttgtggccacagaa
gagtatcggtccattgtttttaaggagcctcggtttgtcgaatatttccgacttgctact
ccggaattggagtatggacgaatgaatattgggagccgtccttcaaaaagaaaaccaagt
ggaggaatcgaatctctgcgtgctatcccctggatatttgcttggacgcaaacgaggttc
caccttcccgtgtggcttggatttggggcagcgtttaaacatgtcttgcagaaggacatc
cgaaacctgcacatgctgcaagagatgtacaatgagtggccatttttcagggtcaccatt
gacttggtggagatggttttcgccaagggagacccaggaattgctgctttgtatgataag
atgctggtatcagaagatctctggtcctttggtgagaaattgagagtgcactatgaagaa
actaagagcttgctcctgcaggttgcagcccataaggatctccttgaaggggacccctac
ttgaagcaaaggctgaggcttcgagattcgtatatcacgactctcaatgtatgccaagct
tatactctgagacggatccgagaccctagctacagtgtgaaggtgaggccacatctctct
aaggaaatcgtggactcgagcaagcctgctgctgagcttgttaagctcaaccccactagt
gagtatgctccaggccttgaggataccctcatattgaccatgaagggtattgctgccgga
cttcagaacactggttag

DBGET integrated database retrieval system