KEGG   Amborella trichopoda: s00022p00062370Help
Entry
s00022p00062370   CDS       T02990                                 

Gene name
AMTR_s00022p00062370
Definition
hypothetical protein
Orthology
K01113  
alkaline phosphatase D [EC:3.1.3.1]
Organism
atr  Amborella trichopoda
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:atr00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    s00022p00062370 (AMTR_s00022p00062370)
Enzymes [BR:atr01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     s00022p00062370 (AMTR_s00022p00062370)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Unknown
AA seq 460 aa AA seqDB search
MALWLHFSCLQLLFVSLLFGVYVFPGFAIGGDEETAISRIAFGSCANQSAPQPIWDGIIN
FKPQLFIWMGDNIYGDNKRPFKLIGKERTVGPWKNVPRFYPASEQELVSRYNKAKTNPGY
SLLRERTRVIGTWDDHDYGLNDAGKEFSRKDTNQKLMLDFLDEAKDSPRRLQAGVYTSYM
FGPPGKQVKVLLLDTRYHRDPLFSDGEMLGTSQWAWLEKEMHRVASQITIIVSSIQVISN
FSATTEPLFHVESWAHFPKERDRLFKLIVNSNRNGVFFISGDVHFGEITRYDCGNRYPLY
DITSSGLTQAVEKAVPSPLAFLIRVAAWLSPSTMRVFNKECRYRSCVYGKPNFGTIEMDW
DANPVSIKFSVRDMNGEPVTSVNVSLSELQAGNMHDSGTPSVAIRGQKHCLLEVDLPWII
RHRLAIFFFGTLTVLVLAMVLMTVAALSVANFCIHKFKLD
NT seq 1383 nt NT seq  +upstreamnt  +downstreamnt
atggctctatggcttcatttctcatgccttcaactcctctttgtttcgcttctctttgga
gtctatgtttttcctggtttcgcaatcggaggagatgaggagactgcgatttcgagaatt
gcgtttggatcctgtgctaatcagagtgctcctcagccaatttgggatggcataataaac
ttcaaaccacagctttttatttggatgggtgataatatttatggggacaataagcggcca
ttcaagcttataggaaaggagaggacagttggaccatggaaaaatgtgccaaggttctat
ccagcctcagagcaagagttggtgtccaggtataacaaggccaagactaatccaggatat
tcacttcttcgagagagaactcgggtcattggcacatgggatgaccatgattatggattg
aatgatgcggggaaagaattttctaggaaggatactaatcaaaagcttatgttagatttc
ttagatgaagccaaagatagtcccaggcgtttgcaagctggtgtgtatacttcttatatg
tttggcccacctggtaaacaagtaaaggtgcttctactggacacacgatatcatagagat
ccgttgtttagtgatggagaaatgttgggaacttctcaatgggcatggttagagaaagag
atgcatcgtgtggcatctcagattaccatcattgtgtcttccattcaggttatatcaaat
ttttctgctactacagagcctttatttcatgtggaatcttgggcacattttccaaaagag
agggaccggctgtttaaactgattgtgaatagcaatagaaatggggtcttcttcatcagt
ggggatgtccattttggagagatcacacgctatgactgtggaaatagatatccactttat
gacataacctcaagtggtctcactcaagcagtagagaaagcagttccatctccacttgct
tttctgatcagagttgcagcttggttgagcccaagtaccatgagagttttcaataaagaa
tgccgatatagatcatgtgtatatggaaaaccaaatttcgggacgattgagatggactgg
gatgccaacccagtgtccataaagttttcagttagggatatgaatggagagcctgtcacc
agcgtaaatgtatcattatcagagttgcaagcaggaaacatgcacgatagtggtacacca
tcagttgccattagagggcaaaagcactgtttgctcgaagtggatctcccatggatcatt
aggcaccgtttagctattttcttctttggtactttgactgttttggttctggcaatggtt
ctcatgactgttgctgctttatctgttgccaacttttgcattcacaaattcaagcttgac
tga

DBGET integrated database retrieval system