KEGG   Amborella trichopoda: s00029p00205400Help
Entry
s00029p00205400   CDS       T02990                                 

Gene name
AMTR_s00029p00205400
Definition
hypothetical protein
Orthology
K09591  
steroid 5-alpha-reductase [EC:1.3.1.22]
Organism
atr  Amborella trichopoda
Pathway
Brassinosteroid biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Castasterone biosynthesis, campesterol => castasterone
Brite
KEGG Orthology (KO) [BR:atr00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00905 Brassinosteroid biosynthesis
    s00029p00205400 (AMTR_s00029p00205400)
Enzymes [BR:atr01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.22  3-oxo-5alpha-steroid 4-dehydrogenase (NADP+)
     s00029p00205400 (AMTR_s00029p00205400)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Unknown
AA seq 268 aa AA seqDB search
MAATPGDSFDSSLYPRALFSLYLICPLTVLPLQLLQAPYGKHSRNGWGPSLSPPLVWFLM
ESPTLWLTLILLPQGRHFHNPQTLALLSPFLFHYLHRTCIFPLRLLHRQKTVISGQKSPG
FPFIIALMAFVFNLFNTYLQARWVSHYSDYGPNWCIGLRFNGGLLVFITGLVINIWADSK
LIALKGEGGGYKIPRGGLFEVISCPNYFGEALEWLGWAILTWSWAGLGFFLYTMANLGPR
ARAHHDWYLKKFADDYPKSRKAMIPFVY
NT seq 807 nt NT seq  +upstreamnt  +downstreamnt
atggcggccacccccggggactccttcgactcatctctgtaccctcgcgccctcttctct
ctctacctaatctgccccctcaccgtcctccctctgcaactcctccaagctccgtacggc
aagcacagccgcaatggatggggcccctccctctcccctcctctggtctggttcttaatg
gaaagccccaccctctggttaaccctaatcctcttaccccaagggcgccatttccacaac
ccacaaaccctagcgctactttctcctttcctcttccactacctccaccgcacctgcatc
tttcctctccgcctcctccaccgccaaaaaaccgtaatttcaggccaaaaatcacctggt
tttcccttcatcatagcactaatggcctttgtgtttaatctcttcaacacttatttacag
gccaggtgggtctctcactatagtgattatgggcctaattggtgcatagggctcaggttt
aatggtggcttactggtttttatcacagggttagtgattaatatatgggcagattccaag
ttaattgctttgaaaggggaaggtgggggttataagatcccaagaggtggattatttgag
gtgattagttgccctaattactttggagaagctttggagtggctcggttgggctatattg
acatggtcatgggctggattagggttttttctatatacaatggccaatttggggcctagg
gctagggcacaccatgattggtatttgaagaagtttgctgatgattatccaaagagcagg
aaggccatgattccttttgtttactag

DBGET integrated database retrieval system