KEGG   Amborella trichopoda: s00067p00092640Help
Entry
s00067p00092640   CDS       T02990                                 

Gene name
AMTR_s00067p00092640
Definition
hypothetical protein
Orthology
K05610  
ubiquitin carboxyl-terminal hydrolase L5 [EC:3.4.19.12]
Organism
atr  Amborella trichopoda
Brite
Enzymes [BR:atr01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     s00067p00092640 (AMTR_s00067p00092640)
Peptidases [BR:atr01002]
 Cysteine Peptidases
  Family C12: ubiquitin C-terminal hydrolase family
   s00067p00092640 (AMTR_s00067p00092640)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Unknown
AA seq 425 aa AA seqDB search
MFGNYPTSKDGYSTLVYKYLCNMNYNMCAKILGQPHTCAWIHVCTLECAWGTLARALGHT
CACVSVSGGMLARALRHTCARVSVSGAGSHVCSDTRVFTELIQQMQVKGLQVEELYSLDL
DSLNSLRPVYGLIFLFKWRPGDKDERLVIKDHSPNLFFASQVINNACATQAILSILLNCP
EIDIGPELSMLKEFTKNFPPELKGLAINNSEAIRTAHNSFARPEPFVADDQRPAEKDDDV
YHFISYLPVDGVLYELDGLKEGPISLGKCPGGRDGLEWLQMVQPVIQERIEKYSKNEIRF
NLMAIIKNRKEIYTVEVKELQKRRECITQQLAAAQAERSGGRIDSSTQSSVIDGLKKSLA
DVTLGIENVTEKILMEEEKFKKWKTENIRRKHNYIPFLFNFLKILAEKKQLKPLIEKARQ
KTSTR
NT seq 1278 nt NT seq  +upstreamnt  +downstreamnt
atgtttgggaattatccgacatcgaaagatgggtattcaactttggtatataaataccta
tgtaatatgaactataatatgtgtgcaaaaatattaggacaacctcacacgtgcgcttgg
atacatgtgtgcacgcttgagtgtgcgtggggcacgctcgcacgtgcgcttggacacacg
tgtgcatgtgtgagtgtgagtgggggcatgctcgcacgtgcgcttagacacacgtgtgca
cgtgtgagtgtgagtggggcaggctctcacgtgtgctcagacacacgtgtttttactgaa
ctaattcagcaaatgcaagtaaaagggttgcaggttgaagagctttactccttagatctg
gattccctcaacagtcttaggcctgtgtatggtctgatattccttttcaaatggaggcca
ggagataaagatgaacgacttgtaattaaagatcacagcccaaatttattttttgccagt
caggtaatcaacaatgcttgtgcaacccaggcaattctctctatcttactgaactgccca
gaaattgacattggtcctgagctctcgatgttaaaggaatttacgaagaatttcccgcct
gagctaaaaggactggccattaacaatagtgaagcaattcgcactgctcacaacagtttt
gctcggcctgagccctttgtggccgatgaccaaagacctgctgaaaaagatgacgatgtg
taccatttcataagctatctgcctgttgatggggttctttatgaactcgatggattaaaa
gaaggccccattagccttggaaagtgccctggaggaagagatggtttggagtggcttcaa
atggttcaaccagtgattcaagaacgcatagagaagtattcaaaaaatgagattaggttt
aaccttatggctatcataaagaataggaaagagatttacacagtcgaagttaaagagctc
caaaagaggagagagtgtatcactcagcagcttgcagctgctcaagcggagagatcgggg
gggagaatagattcgagtacccaaagtagtgtgattgacgggctaaagaaatcacttgca
gatgtgaccttgggtatcgagaatgtgactgagaagatattgatggaggaggagaagttc
aagaagtggaagactgaaaacataaggaggaagcataattacattcccttcctgttcaat
ttcttgaagatattggccgagaagaagcagttaaagcctcttattgagaaggcaaggcag
aaaaccagcacaagatga

DBGET integrated database retrieval system