KEGG   Amborella trichopoda: s00099p00047790Help
Entry
s00099p00047790   CDS       T02990                                 

Gene name
AMTR_s00099p00047790
Definition
hypothetical protein
Orthology
K17108  
non-lysosomal glucosylceramidase [EC:3.2.1.45]
Organism
atr  Amborella trichopoda
Pathway
Other glycan degradation
Sphingolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:atr00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    s00099p00047790 (AMTR_s00099p00047790)
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    s00099p00047790 (AMTR_s00099p00047790)
Enzymes [BR:atr01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.45  glucosylceramidase
     s00099p00047790 (AMTR_s00099p00047790)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Unknown
AA seq 948 aa AA seqDB search
MLTYGFIEEKNDSAKDFTTEVFVDPGQPAPLTWHRKINTNRDALSEFTLTMLEKLKMASL
GIRMWRHINEEHSKGRTAVIDPFNPQIKHTSCHGIPLGGIGAGSIGRSYKGEFQRWQLFP
GICEDEAVLANQFSVFISRPNGKSFSTVLHPGRPDVLKDHTISGIGSWDWNLNGEHSTYH
ALYPRAWTVYEDEPDPDLKIVCRQISPIIPNNYRESSLPVTVFTFTLINSGKDAADVSLL
FTFANSVGGQSEFSGNHLNSQLRMMDGVRGVTLCHKVVNGQPEVTFAIAAQETNDVHVSE
CPSFVISGNSQGFSARDMWHEVKEHGSFDRLISSATTIPSEPESSIGAAVVASVTVPPHT
VRNVTFSLAWACSKVKFPSGKIYHRRYTTFYGTQGDAAAKLVHDAILEHGSWESQIEAWQ
KPIIQDKTLPEWYRITLFNELYYLNAGGTIWTDGLPPIESQVCVEDRKFSLDKSNFENTT
SLGRENDTAIGILDRMTSILEEMQNPSTANSAFGPTLLLKDEENIGQFLYYEGIEYHMWN
TYDVHFYASFALIMLFPKLELSIQRDFAAAVMMHDPERMKTLQDGKWVPRKVLGAVPHDL
GLNDPWFEVNAYNIHDVNRWKDLNPKFVLQVYRDMVFTGDKSFAHSVWPSVYMAMAYMDQ
FDKDRDGMIENEGFPDQTYDVWSVTGVSAYTGGLWVAALQAASAMAHEVGDNASADYFWH
KFENAKRVYGTLWNGSYFNYDNSDGAYSSSIQADQLAGQWYARACGLVPIVDDEKAQSAL
EKVYQFNVLKLGDGKRGAVNGMLPNGTVDMSTMQSREIWTGVTYAVAAAMIQEGMEDSAF
KTAEGIYEASWSPEGLGYSFQTPEAWNTNGEFRSLSYMRPLAIWAIQWALSPPVLNNKTQ
KPRKTTDSSLKHHVGFSKVAELLRLPKEESAPGLLKYLYDCTCRRFRH
NT seq 2847 nt NT seq  +upstreamnt  +downstreamnt
atgctgacatatggtttcattgaagagaagaatgattccgctaaggatttcactacagag
gtctttgttgatccagggcaaccagcacctttgacttggcatcgcaaaataaacactaac
cgggatgccctttcagaattcactcttactatgcttgaaaagctgaagatggctagttta
ggtattcgaatgtggcgccatatcaacgaagaacattctaaaggacggacagctgttatt
gatccgtttaatccacagataaagcatacatcttgtcatggcatccctcttggtgggatt
ggtgcaggaagcatcgggagaagttacaaaggcgagtttcaacgctggcaactgttccct
ggaatttgtgaagatgaagctgtcttggcaaaccaattttctgttttcatttcacgtcca
aatgggaaaagtttttctactgtattacaccctggtcgcccagatgtgctcaaagatcat
actatttcaggcattggatcttgggattggaaccttaatggggaacattctacttaccat
gctttatatccaagggcttggacagtgtatgaagatgaacctgatccagatcttaaaata
gtatgcagacagatttcaccaattattccaaataattatcgggagagtagtttacctgta
accgtattcacattcacgctaataaattctgggaaggatgctgccgatgtcagcttactt
ttcacatttgctaattctgttgggggacaatcagagttctctggcaatcatctcaattcc
caactgaggatgatggatggtgtgcgtggagtgactctatgccacaaggtggtaaatggg
caaccagaagtaacatttgctatagcagcccaagagaccaatgatgttcatgtctctgaa
tgccccagctttgtgatctctggaaattctcaaggattctcagcaagagacatgtggcat
gaagttaaagagcatggatcatttgatcggcttatttccagtgccacaaccataccttcg
gaaccagaatcatccattggagctgctgtggtagcctcagttactgttccacctcacaca
gttcgaaatgttacattttctctagcatgggcatgttctaaagtcaaatttcctagtgga
aaaatttatcacaggcggtacaccacattttatggcactcaaggggatgctgcggccaaa
cttgtacacgatgctattctagagcatggcagttgggagtcccaaattgaagcatggcaa
aagccaattatacaagataaaacccttccagaatggtaccgcatcacccttttcaacgag
ttgtactatcttaatgctggaggaacaatttggacagatgggttacctcctatcgagagt
caagtttgtgtagaagatagaaagttctccctagacaaatcaaattttgagaacaccact
tccttaggtcgtgaaaatgatactgcaattgggatcctcgaccgaatgacatccatacta
gaagaaatgcaaaatccaagcacagctaattcagcctttggacccacattactcctaaag
gatgaggaaaacattgggcagttcctctattatgagggcatcgaatatcacatgtggaat
acttatgacgtccatttctatgcatcatttgcattaatcatgctcttcccaaagcttgag
ctaagcatccaaagagactttgctgctgcggtgatgatgcatgatccagagagaatgaaa
accctacaagatggtaagtgggtcccacgaaaggttcttggtgcagtcccccatgaccta
gggctaaacgacccctggtttgaagtgaacgcttataacattcatgatgtgaatagatgg
aaggatttgaatccaaaatttgttctccaagtttacagagacatggtattcaccggagat
aaatcatttgctcattcagtgtggccttctgtctatatggcgatggcttatatggaccaa
ttcgacaaggatagagatgggatgattgagaatgaaggctttcctgatcaaacttatgat
gtgtggtcagtgactggtgttagtgcatacactggggggctttgggtggcggccttgcaa
gcggcttctgcaatggcccatgaggttggtgacaatgcttctgcagattatttttggcat
aagtttgagaatgcaaaacgtgtttatgggacattatggaatggttcttacttcaattat
gacaatagtgatggcgcatatagttcgtccattcaagccgatcaattagcagggcaatgg
tatgcaagggcatgtgggcttgtaccaattgttgatgatgagaaagcacaaagtgcactg
gaaaaagtgtatcagttcaatgtgttgaagttgggtgatggtaagagaggagctgtcaat
ggaatgctaccaaatggaactgttgatatgagcaccatgcaatctagagagatatggacg
ggagtgacatatgctgtggcggctgctatgattcaagaaggcatggaagattctgcattt
aagacagcagaaggaatctatgaagcctcttggtctccagaggggcttgggtactctttc
cagactcctgaagcttggaacacaaatggtgaattccgatcgttatcttacatgcgccct
ctcgccatctgggcaattcaatgggccctctctcctcccgttttgaacaacaaaactcaa
aagcctagaaaaacaacggatagctctctcaaacatcatgtgggtttctcaaaggttgcg
gagttacttagattaccaaaagaggaaagtgctcccggcttattgaaatatctctacgat
tgcacttgcagaagatttaggcactga

DBGET integrated database retrieval system