KEGG   Amborella trichopoda: s00104p00089460Help
Entry
s00104p00089460   CDS       T02990                                 

Gene name
AMTR_s00104p00089460
Definition
hypothetical protein
Orthology
K14156  
choline/ethanolamine kinase [EC:2.7.1.32 2.7.1.82]
Organism
atr  Amborella trichopoda
Pathway
Glycerophospholipid metabolism
Metabolic pathways
Module
Phosphatidylethanolamine (PE) biosynthesis, ethanolamine => PE
Brite
KEGG Orthology (KO) [BR:atr00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    s00104p00089460 (AMTR_s00104p00089460)
Enzymes [BR:atr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.32  choline kinase
     s00104p00089460 (AMTR_s00104p00089460)
    2.7.1.82  ethanolamine kinase
     s00104p00089460 (AMTR_s00104p00089460)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Unknown
AA seq 462 aa AA seqDB search
MVAVETDNTLGSLEVNGSEIGVPKDAKKILMSLASKWSDVVDAEHLEIVPLKGAMTNEVF
QCHWPTAEGEVPRKVLLRIYGEGVDIFFDREDEIRTFECMSKHGQGPRLLGRFQKGRIEE
FIHARTLSAPDLQDPEVSALIAAKLREFHDLDMPGPKNARLWDRLRSWLKEARKVCPPEE
AKDFRLDIMEEEIKSLQQELSADNQKIGFCHNDLQYGNIMMDEENKSITIIDYEYSCYNP
VAVDIANHFCEMAANYHTETPHILDYSKYPDHEERKRFVEAYLNSSGEQASHAEVEQLLN
DAEKYTLASHLIWGLWGIISAHVNDIAFDYRDYARQRFEQYWTKRAAASMAYGEYAKSSI
LVWNSATIEKSASSFVQSGDDDDLNVYGFHLDSVNLTFKVIVRSGHADQNYEFDCDRALE
IGSRHVDMEDMSIELYLCVQGECYEVGFTDGVYNKPFGIRTR
NT seq 1389 nt NT seq  +upstreamnt  +downstreamnt
atggtggctgttgagactgataatactttgggcagtctagaggtgaatggctcagagatt
ggcgtccctaaagatgcaaagaagattttgatgtctttggcctctaagtggagtgatgta
gtggatgcagaacatttggagattgttcctttgaagggagccatgacgaatgaggttttt
cagtgtcattggccaacagctgagggagaggttcctcgaaaagtcctgctcagaatatat
ggtgaaggtgtcgatattttttttgatagagaagatgagattaggaccttcgagtgcatg
tctaagcatgggcaggggcctcgtttgttgggtcggtttcaaaaggggcgtattgaggaa
ttcattcatgctcggacactttcagcacctgatctgcaagatccagaagtgtctgcgctc
atcgcagcaaagttgagagagttccatgatctagatatgcctggtccaaagaacgctcgc
ctttgggatcgactgaggagttggctcaaggaagccagaaaagtgtgtcctccagaggaa
gctaaagactttcgcttggacattatggaagaagagataaaatctctacaacaagaactc
tcagcagataatcaaaagattgggttttgccataatgatcttcagtatggaaatattatg
atggatgaagagaacaaatcaataaccataattgactacgaatactcttgttacaatcct
gttgcagttgatattgcaaatcacttctgtgagatggctgctaactaccatactgagaca
cctcatattttggactacagcaaataccccgatcatgaggagcgcaaaaggtttgtagag
gcatacctcaattcatcaggtgaacaggcgagtcatgctgaagttgaacaacttttgaat
gatgctgagaagtacacacttgccagccatcttatttggggcctatggggaatcatctcc
gcgcatgtaaacgatatcgcctttgactacagggattatgcaagacagaggttcgagcaa
tactggacgaagagggccgcagcttcaatggcatacggtgaatatgcaaaatcttcaatt
ttagtgtggaactctgctaccatagagaagagtgcctcttcatttgttcaatctggtgat
gatgatgatctcaacgtttatggttttcacctggactctgtgaacttgacttttaaggtg
attgtaagatctgggcatgcagatcagaactatgagttcgattgtgaccgtgcattggaa
attggcagccgccatgttgacatggaggacatgagcatcgagctgtacctctgtgtgcaa
ggggagtgttatgaggtcgggtttacggatggagtttacaacaaaccatttggaattaga
acccgatga

DBGET integrated database retrieval system