KEGG   Amborella trichopoda: s00111p00123040Help
Entry
s00111p00123040   CDS       T02990                                 

Gene name
AMTR_s00111p00123040
Definition
hypothetical protein
Orthology
K05609  
ubiquitin carboxyl-terminal hydrolase L3 [EC:3.4.19.12]
Organism
atr  Amborella trichopoda
Brite
Enzymes [BR:atr01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     s00111p00123040 (AMTR_s00111p00123040)
Peptidases [BR:atr01002]
 Cysteine Peptidases
  Family C12: ubiquitin C-terminal hydrolase family
   s00111p00123040 (AMTR_s00111p00123040)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Unknown
AA seq 224 aa AA seqDB search
MGCYLICQTFLWGLGLPEEEAEFYDVYGLDEELLEMVPKPVLAVLFLYPITAESEAERKL
EEEQEVLEKGKEGNDEVYFMRQTVGNACGTVGLLHAMGNVHSEIKLIEGSYLDKFFKATA
NMDPLERANFLEKDTEMEAAHSVAATAGDTEAPDVNTNVDTHFICFTCVNGGLYELDGRK
SQTVLHGPSSPNTLLEDAAKVIKEFIEKNPGSLNFNVIALSKKT
NT seq 675 nt NT seq  +upstreamnt  +downstreamnt
atgggatgctatcttatctgccaaacttttctatgggggcttggtcttccagaggaagag
gcagagttttatgatgtatatggtttagatgaagaactcttggaaatggtgcccaagcct
gtcctggcagtgcttttcctataccccatcacagctgagagtgaagctgagagaaaattg
gaggaagaacaagaagttctggagaaagggaaggagggaaatgatgaagtatattttatg
agacaaacagtgggcaatgcatgtggaactgttgggcttcttcatgctatggggaatgta
cattctgaaattaagctcatcgaggggtcttacttggacaagttctttaaagcaacggca
aacatggatccattggagcgtgcaaattttcttgagaaggacacggaaatggaagctgca
cacagtgtagcagctactgctggggacacagaggccccagatgtgaacaccaatgttgac
actcatttcatatgcttcacgtgcgtgaatggaggactttatgagcttgatgggaggaag
tctcagactgtgttgcatggtccatcatcacccaacactttgctcgaggacgccgcaaag
gttataaaagaattcattgagaagaatcctggctctttgaatttcaatgtcattgctctc
tcaaagaaaacatag

DBGET integrated database retrieval system