KEGG   Amborella trichopoda: s00119p00071880Help
Entry
s00119p00071880   CDS       T02990                                 

Gene name
AMTR_s00119p00071880
Definition
hypothetical protein
Orthology
K00326  
cytochrome-b5 reductase [EC:1.6.2.2]
Organism
atr  Amborella trichopoda
Pathway
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:atr00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    s00119p00071880 (AMTR_s00119p00071880)
Enzymes [BR:atr01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.2  With a heme protein as acceptor
    1.6.2.2  cytochrome-b5 reductase
     s00119p00071880 (AMTR_s00119p00071880)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Unknown
AA seq 277 aa AA seqDB search
MELMQTPHIEILGIAVAVLAIGAGAAYLYLSKKPKGCLDPENFRDFKLVKKTQLSHNVAK
FRFDLPTPTSVLGLPIGQHISCRGNDSVGEEVIKPYTPTTLDSDVGYFELVIKMYPQGRM
SHHFREMRVGDYMSVKGPKGRFKYQPGQVRAFGMLAGGSGITPMFQVARAILENPKDSTK
IHLIYANVTVDDILLKEELDSMATNYPSRFKVYYVLNQPPEVWNGGVGFVSKEMIQAHCP
APASDIQILRCGPPPMNKAMAAHLDELGYMKEMQFQF
NT seq 834 nt NT seq  +upstreamnt  +downstreamnt
atggagcttatgcagacaccccacatcgagattttgggaattgcagtcgctgttctcgcc
atcggagctggtgctgcttatctctaccttagcaaaaaacccaaaggttgcttggatcct
gagaactttagggatttcaaattggtgaaaaagacacagttgagccataacgtggccaag
ttccggtttgatcttcctactcctacatctgtattgggtctcccaattgggcaacatata
agttgcaggggcaacgatagtgttggagaagaagtcatcaagccttataccccaactaca
ttggattctgatgttggatattttgaattggttattaagatgtatcctcagggaagaatg
tctcatcatttccgggagatgcgtgttggtgattatatgtctgtaaaaggtcctaagggc
cgttttaaatatcaacctggtcaagttagggcattcggaatgctagctggaggatcaggc
atcacgccaatgtttcaggtggctagagctatattggagaaccccaaggacagtaccaaa
atacatctcatttatgcaaatgtgactgtagatgacattctcttgaaggaagagcttgat
agcatggcaactaactaccccagccgcttcaaagtgtactatgttctgaatcagcctccc
gaggtatggaatggtggtgtaggtttcgtttcgaaggaaatgattcaagcccattgccct
gcacctgcttctgacatccagatcttgagatgtggcccaccaccaatgaataaggccatg
gcagctcacctcgacgagctcggctacatgaaagagatgcagttccaattctga

DBGET integrated database retrieval system